Recombinant Human SLC4A9 Protein, GST-tagged
| Cat.No. : | SLC4A9-31H |
| Product Overview : | Recombinant Human SLC4A9 Protein(275-384 aa), fused with N-terminal GST Tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | 275-384 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.0). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 100mM GSH. |
| AASequence : | LGKGYHEMGRAAAVLLSDPQFQWSVRRASNLHDLLAALDAFLEEVTVLPPGRWDPTARIPPPKCLPSQHKRLPSQQREIRGPAVPRLTSAEDRHRHGPHAHSPELQRTGR |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 12 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage. |
| ◆ Recombinant Proteins | ||
| SLC4A9-31H | Recombinant Human SLC4A9 Protein, GST-tagged | +Inquiry |
| SLC4A9-30H | Recombinant Human SLC4A9 Protein, His-tagged | +Inquiry |
| SLC4A9-5555R | Recombinant Rat SLC4A9 Protein | +Inquiry |
| SLC4A9-5214R | Recombinant Rat SLC4A9 Protein, His (Fc)-Avi-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SLC4A9 Products
Required fields are marked with *
My Review for All SLC4A9 Products
Required fields are marked with *



