Recombinant Human SLC51B protein, GST-tagged
| Cat.No. : | SLC51B-7454H |
| Product Overview : | Recombinant Human SLC51B protein(1-128 aa), fused with N-terminal GST tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | 1-128 aa |
| Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 8.0). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 100 mM reduced glutathione (GSH). |
| AASequence : | MEHSEGAPGDPAGTVVPQELLEEMLWFFRVEDASPWNHSILALAAVVVIISMVLLGRSIQASRKEKMQPPEKETPEVLHLDEAKDHNSLNNLRETLLSEKPNLAQVELELKERDVLSVFLPDVPETES |
| Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
| Gene Name | SLC51B solute carrier family 51, beta subunit [ Homo sapiens ] |
| Official Symbol | SLC51B |
| Synonyms | OSTB; OSTBETA |
| Gene ID | 123264 |
| mRNA Refseq | NM_178859.3 |
| Protein Refseq | NP_849190.2 |
| MIM | 612085 |
| UniProt ID | Q86UW2 |
| ◆ Recombinant Proteins | ||
| SLC51B-5327H | Recombinant Human SLC51B Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| SLC51B-0463H | Recombinant Human SLC51B Protein (G2-S128), 8×His-MBP, Flag tagged | +Inquiry |
| SLC51B-283H | Recombinant Human solute carrier family 51, beta subunit, His-tagged | +Inquiry |
| SLC51B-7454H | Recombinant Human SLC51B protein, GST-tagged | +Inquiry |
| Slc51b-5939M | Recombinant Mouse Slc51b Protein, Myc/DDK-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| SLC51B-3523HCL | Recombinant Human OSTBETA 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SLC51B Products
Required fields are marked with *
My Review for All SLC51B Products
Required fields are marked with *
