Recombinant Human SLC52A1 Protein

Cat.No. : SLC52A1-5211H
Product Overview : Human GPR172B full-length ORF (NP_060456.2) recombinant protein without tag.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Description : GPCR41 (MIM 607882) and GPCR42 act as receptors for porcine endogenous retrovirus subgroup A (PERV-A).[supplied by OMIM
Form : Liquid
Molecular Mass : 46.4 kDa
AA Sequence : MAAPTLGRLVLTHLLVALFGMGSWAAVNGIWVELPVVVKDLPEGWSLPSYLSVVVALGNLGLLVVTLWRRLAPGKGEQVPIQVVQVLSVVGTALLAPLWHHVAPVAGQLHSVAFLTLALVLAMACCTSNVTFLPFLSHLPPPFLRSFFLGQGLSALLPCVLALVQGVGRLECPPAPTNGTSGPPLDFPERFPASTFFWALTALLVTSAAAFRGLLLLLPSLPSVTTGGSGPELQLGSPGAEEEEKEEEEALPLQEPPSQAAGTIPGPDPEVHQLFSAHGAFLLGLMAFTSAVTNGVLPSVQSFSCLPYGRLAYHLAVVLGSAANPLACFLAMGVLCRSLAGLVGLSLLGMLFGAYLMALAILSPCPPLVGTTAGVVLVVLSWVLCLCVFSYVKVAASSLLHGGGRPALLAAGVAIQVGSLLGAGAMFPPTSIYHVFQSRKDCVDPCGP
Applications : Antibody Production
Functional Study
Compound Screening
Usage : Heating may cause protein aggregation. Please do not heat this product before electrophoresis.
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 25 mM Tris-HCl of pH8.0 containing 2% glycerol.
Gene Name SLC52A1 solute carrier family 52 member 1 [ Homo sapiens (human) ]
Official Symbol SLC52A1
Synonyms SLC52A1; solute carrier family 52 member 1; PAR2; RFT1; RBFVD; RFVT1; hRFT1; GPCR42; GPR172B; solute carrier family 52, riboflavin transporter, member 1; G protein-coupled receptor 172B; G-protein coupled receptor GPCR42; PERV-A receptor 2; porcine endogenous retrovirus A receptor 2; solute carrier family 52 (riboflavin transporter), member 1
Gene ID 55065
mRNA Refseq NM_001104577
Protein Refseq NP_001098047
MIM 607883
UniProt ID Q9NWF4

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All SLC52A1 Products

Required fields are marked with *

My Review for All SLC52A1 Products

Required fields are marked with *

0
cart-icon