Recombinant Human SLC6A1 protein, GST-tagged

Cat.No. : SLC6A1-1796H
Product Overview : Recombinant Human SLC6A1 protein(1-52 aa), fused to GST tag, was expressed in E. coli.
Availability October 08, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : GST
Protein Length : 1-52 aa
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 100mM GSH.
AA Sequence : MATNGSKVADGQISTEVSEAPVANDKPKTLVVKVQKKAADLPDRDTWKGRFD
Purity : 90%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks).
Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
Reconstitution : Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.
Gene Name SLC6A1 solute carrier family 6 (neurotransmitter transporter, GABA), member 1 [ Homo sapiens ]
Official Symbol SLC6A1
Synonyms SLC6A1; solute carrier family 6 (neurotransmitter transporter, GABA), member 1; sodium- and chloride-dependent GABA transporter 1; GABATHG; GABATR; GAT1; GAT-1; solute carrier family 6 member 1;
Gene ID 6529
mRNA Refseq NM_003042
Protein Refseq NP_003033
MIM 137165
UniProt ID P30531

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All SLC6A1 Products

Required fields are marked with *

My Review for All SLC6A1 Products

Required fields are marked with *

0
cart-icon
0
compare icon