Recombinant Human SLC6A14 protein, Myc-tagged
Cat.No. : | SLC6A14-4644H |
Product Overview : | Recombinant Human SLC6A14 protein(Q9UN76)(131-234 aa), fused with C-terminal Myc tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | Myc |
Protein Length : | 131-234 aa |
Form : | For liquid formulations, the standard storage buffer consists of a Tris or PBS based solution supplemented with 5-50% glycerol. When provided as lyophilized powder, the product undergoes freeze-drying from a Tris- or PBS-based formulation containing 6% trehalose, adjusted to pH 8.0 prior to the lyophilization process. |
Molecular Mass : | 13.3 kDa |
AASequence : | YYNVIIAYSLYYMFASFQSELPWKNCSSWSDKNCSRSPIVTHCNVSTVNKGIQEIIQMNKSWVDINNFTCINGSEIYQPGQLPSEQYWNKVALQRSSGMNETGV |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein indeionized sterile water to a concentration of 0.1-1.0 mg/mL. Aliquot for long-term storage at -80°C. |
Gene Name | SLC6A14 solute carrier family 6 (amino acid transporter), member 14 [ Homo sapiens ] |
Official Symbol | SLC6A14 |
Synonyms | SLC6A14; solute carrier family 6 (amino acid transporter), member 14; solute carrier family 6 (neurotransmitter transporter), member 14; sodium- and chloride-dependent neutral and basic amino acid transporter B(0+); amino acid transporter B0+; amino acid transporter ATB0+; solute carrier family 6 member 14; BMIQ11; |
Gene ID | 11254 |
mRNA Refseq | NM_007231 |
Protein Refseq | NP_009162 |
MIM | 300444 |
UniProt ID | Q9UN76 |
◆ Recombinant Proteins | ||
SLC6A14-0671H | Recombinant Human SLC6A14 Protein (D2-E642), 8×His-MBP, Flag tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SLC6A14 Products
Required fields are marked with *
My Review for All SLC6A14 Products
Required fields are marked with *
0
Inquiry Basket