Recombinant Human SLC6A14 protein, Myc-tagged

Cat.No. : SLC6A14-4644H
Product Overview : Recombinant Human SLC6A14 protein(Q9UN76)(131-234 aa), fused with C-terminal Myc tag, was expressed in E.coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : Myc
Protein Length : 131-234 aa
Form : For liquid formulations, the standard storage buffer consists of a Tris or PBS based solution supplemented with 5-50% glycerol. When provided as lyophilized powder, the product undergoes freeze-drying from a Tris- or PBS-based formulation containing 6% trehalose, adjusted to pH 8.0 prior to the lyophilization process.
Molecular Mass : 13.3 kDa
AASequence : YYNVIIAYSLYYMFASFQSELPWKNCSSWSDKNCSRSPIVTHCNVSTVNKGIQEIIQMNKSWVDINNFTCINGSEIYQPGQLPSEQYWNKVALQRSSGMNETGV
Purity : Greater than 85% as determined by SDS-PAGE.
Storage : Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : Please reconstitute protein indeionized sterile water to a concentration of 0.1-1.0 mg/mL. Aliquot for long-term storage at -80°C.
Gene Name SLC6A14 solute carrier family 6 (amino acid transporter), member 14 [ Homo sapiens ]
Official Symbol SLC6A14
Synonyms SLC6A14; solute carrier family 6 (amino acid transporter), member 14; solute carrier family 6 (neurotransmitter transporter), member 14; sodium- and chloride-dependent neutral and basic amino acid transporter B(0+); amino acid transporter B0+; amino acid transporter ATB0+; solute carrier family 6 member 14; BMIQ11;
Gene ID 11254
mRNA Refseq NM_007231
Protein Refseq NP_009162
MIM 300444
UniProt ID Q9UN76

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All SLC6A14 Products

Required fields are marked with *

My Review for All SLC6A14 Products

Required fields are marked with *

0
cart-icon
0
compare icon