Recombinant Human SLC6A14 protein, Myc-tagged

• Cat.No.: SLC6A14-4644H
• Product Overview: Recombinant Human SLC6A14 protein(Q9UN76)(131-234 aa), fused with C-terminal Myc tag, was expressed in E.coli.

Specification

• Species: Human
• Source: E.coli
• Tag: Myc
• Protein Length: 131-234 aa
• Form: For liquid formulations, the standard storage buffer consists of a Tris or PBS based solution supplemented with 5-50% glycerol. When provided as lyophilized powder, the product undergoes freeze-drying from a Tris- or PBS-based formulation containing 6% trehalose, adjusted to pH 8.0 prior to the lyophilization process.
• Molecular Mass: 13.3 kDa
• AASequence: YYNVIIAYSLYYMFASFQSELPWKNCSSWSDKNCSRSPIVTHCNVSTVNKGIQEIIQMNKSWVDINNFTCINGSEIYQPGQLPSEQYWNKVALQRSSGMNETGV
• Purity: Greater than 85% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein indeionized sterile water to a concentration of 0.1-1.0 mg/mL. Aliquot for long-term storage at -80°C.

Gene Information

• Gene Name: SLC6A14 solute carrier family 6 (amino acid transporter), member 14 [ Homo sapiens ]
• Official Symbol: SLC6A14
• Synonyms: SLC6A14; solute carrier family 6 (amino acid transporter), member 14; solute carrier family 6 (neurotransmitter transporter), member 14; sodium- and chloride-dependent neutral and basic amino acid transporter B(0+); amino acid transporter B0+; amino acid transporter ATB0+; solute carrier family 6 member 14; BMIQ11
• Gene ID: 11254
• mRNA Refseq: NM_007231
• Protein Refseq: NP_009162
• MIM: 300444
• UniProt ID: Q9UN76