Recombinant Human SLC6A3
Cat.No. : | SLC6A3-26889TH |
Product Overview : | Recombinant fragment corresponding to amino acids 161-237 of Human Dopamine Transporter with proprietary tag; Predicted MWt 34.10 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 77 amino acids |
Description : | This gene encodes a dopamine transporter which is a member of the sodium- and chloride-dependent neurotransmitter transporter family. The 3 UTR of this gene contains a 40 bp tandem repeat, referred to as a variable number tandem repeat or VNTR, which can be present in 3 to 11 copies. Variation in the number of repeats is associated with idiopathic epilepsy, attention-deficit hyperactivity disorder, dependence on alcohol and cocaine, susceptibility to Parkinson disease and protection against nicotine dependence. |
Molecular Weight : | 34.100kDa inclusive of tags |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.31% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | AWALHYLFSSFTTELPWIHCNNSWNSPNCSDAHPGDSSGDSSGLNDTFGTTPAAEYFERGVLHLHQSHGIDDLGPPR |
Sequence Similarities : | Belongs to the sodium:neurotransmitter symporter (SNF) (TC 2.A.22) family. SLC6A3 subfamily. |
Gene Name | SLC6A3 solute carrier family 6 (neurotransmitter transporter, dopamine), member 3 [ Homo sapiens ] |
Official Symbol | SLC6A3 |
Synonyms | SLC6A3; solute carrier family 6 (neurotransmitter transporter, dopamine), member 3; DAT1; sodium-dependent dopamine transporter; DAT; dopamine transporter; |
Gene ID | 6531 |
mRNA Refseq | NM_001044 |
Protein Refseq | NP_001035 |
MIM | 126455 |
Uniprot ID | Q01959 |
Chromosome Location | 5p15.3 |
Pathway | Alpha-synuclein signaling, organism-specific biosystem; Dopamine clearance from the synaptic cleft, organism-specific biosystem; Dopaminergic synapse, organism-specific biosystem; Dopaminergic synapse, conserved biosystem; Monoamine Transport, organism-specific biosystem; |
Function | dopamine binding; dopamine transmembrane transporter activity; dopamine:sodium symporter activity; drug binding; monoamine transmembrane transporter activity; |
◆ Recombinant Proteins | ||
SLC6A3-696HFL | Recombinant Full Length Human SLC6A3 Protein, N-GST-tagged | +Inquiry |
SLC6A3-1724H | Recombinant Human SLC6A3 protein, His & GST-tagged | +Inquiry |
SLC6A3-5229R | Recombinant Rat SLC6A3 Protein, His (Fc)-Avi-tagged | +Inquiry |
SLC6A3-5570R | Recombinant Rat SLC6A3 Protein | +Inquiry |
SLC6A3-26889TH | Recombinant Human SLC6A3 | +Inquiry |
◆ Cell & Tissue Lysates | ||
SLC6A3-1637HCL | Recombinant Human SLC6A3 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SLC6A3 Products
Required fields are marked with *
My Review for All SLC6A3 Products
Required fields are marked with *
0
Inquiry Basket