Recombinant Human SLC6A5 protein, His-tagged
Cat.No. : | SLC6A5-2951H |
Product Overview : | Recombinant Human SLC6A5 protein(1-200 aa), fused with N-terminal His tag, was expressed in E.coli. |
Availability | August 09, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-200 aa |
Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 7.4). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 300 mM imidazole. |
AASequence : | MDCSAPKEMNKLPANSPEAAAAQGHPDGPCAPRTSPEQELPAAAAPPPPRVPRSASTGAQTFQSADARACEAERPGVGSCKLSSPRAQAASAALRDLREAQGAQASPPPGSSGPGNALHCKIPSLRGPEGDANVSVGKGTLERNNTPVVGWVNMSQSTVVLGTDGITSVLPGSVATVATQEDEQGDENKARGNWSSKLDF |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
Gene Name | SLC6A5 solute carrier family 6 (neurotransmitter transporter, glycine), member 5 [ Homo sapiens ] |
Official Symbol | SLC6A5 |
Synonyms | SLC6A5; solute carrier family 6 (neurotransmitter transporter, glycine), member 5; NET1; sodium- and chloride-dependent glycine transporter 2; GLYT2; GLYT-2; |
Gene ID | 9152 |
mRNA Refseq | NM_004211 |
Protein Refseq | NP_004202 |
MIM | 604159 |
UniProt ID | Q9Y345 |
◆ Recombinant Proteins | ||
SLC6A5-683H | Recombinant Human SLC6A5 | +Inquiry |
SLC6A5-1947Z | Recombinant Zebrafish SLC6A5 | +Inquiry |
SLC6A5-1207H | Recombinant Human SLC6A5 Protein (D2-C797), 8×His-Strep, Flag tagged | +Inquiry |
SLC6A5-6733H | Recombinant Human SLC6A5 protein, GST-tagged | +Inquiry |
SLC6A5-2951H | Recombinant Human SLC6A5 protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SLC6A5-1704HCL | Recombinant Human SLC6A5 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SLC6A5 Products
Required fields are marked with *
My Review for All SLC6A5 Products
Required fields are marked with *