Recombinant Human SLC7A11 protein, GST-tagged
Cat.No. : | SLC7A11-301337H |
Product Overview : | Recombinant Human SLC7A11 (1-42 aa) protein, fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
Source : | E. coli |
Species : | Human |
Tag : | GST |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
Protein length : | Met1-Arg42 |
AA Sequence : | MVRKPVVSTISKGGYLQGNVNGRLPSLGNKEPPGQEKVQLKR |
Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Stability : | Store for up to 12 months at -20°C to -80°C as lyophilized powder. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Gene Name : | SLC7A11 solute carrier family 7 (anionic amino acid transporter light chain, xc- system), member 11 [ Homo sapiens ] |
Official Symbol : | SLC7A11 |
Synonyms : | SLC7A11; solute carrier family 7 (anionic amino acid transporter light chain, xc- system), member 11; cystine/glutamate transporter; xCT; amino acid transport system xc-; solute carrier family 7 member 11; calcium channel blocker resistance protein CCBR1; solute carrier family 7, (cationic amino acid transporter, y+ system) member 11; CCBR1; |
Gene ID : | 23657 |
mRNA Refseq : | NM_014331 |
Protein Refseq : | NP_055146 |
MIM : | 607933 |
UniProt ID : | Q9UPY5 |
Products Types
◆ Recombinant Protein | ||
SLC7A11-11H | Recombinant Human SLC7A11 Protein | +Inquiry |
SLC7A11-01H | Recombinant Human SLC7A11 Protein, His-tagged | +Inquiry |
SLC7A11-4127R | Recombinant Rhesus Macaque SLC7A11 Protein, His (Fc)-Avi-tagged | +Inquiry |
Slc7a11-2080M | Recombinant Mouse Slc7a11 Protein, His-tagged | +Inquiry |
SLC7A11-30700TH | Recombinant Human SLC7A11 protein, GST-tagged | +Inquiry |
◆ Lysates | ||
SLC7A11-1698HCL | Recombinant Human SLC7A11 293 Cell Lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
0
Inquiry Basket