Recombinant Human SLC7A7 protein, His-tagged
Cat.No. : | SLC7A7-2525H |
Product Overview : | Recombinant Human SLC7A7 protein(459-511 aa), fused to His tag, was expressed in E. coli. |
Availability | August 09, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 459-511 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | LIIRVPEHKRPLYLRRIVGSATRYLQVLCMSVAAEMDLEDGGEMPKQRDPKSN |
Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | SLC7A7 solute carrier family 7 (amino acid transporter light chain, y+L system), member 7 [ Homo sapiens ] |
Official Symbol | SLC7A7 |
Synonyms | SLC7A7; solute carrier family 7 (amino acid transporter light chain, y+L system), member 7; LPI; Y+L amino acid transporter 1; y+LAT 1; monocyte amino acid permease 2; y(+)L-type amino acid transporter 1; solute carrier family 7 (cationic amino acid transporter, y+ system), member 7; LAT3; MOP-2; Y+LAT1; y+LAT-1; |
Gene ID | 9056 |
mRNA Refseq | NM_001126105 |
Protein Refseq | NP_001119577 |
MIM | 603593 |
UniProt ID | Q9UM01 |
◆ Recombinant Proteins | ||
SLC7A7-8426M | Recombinant Mouse SLC7A7 Protein, His (Fc)-Avi-tagged | +Inquiry |
SLC7A7-15522M | Recombinant Mouse SLC7A7 Protein | +Inquiry |
SLC7A7-5578R | Recombinant Rat SLC7A7 Protein | +Inquiry |
SLC7A7-2525H | Recombinant Human SLC7A7 protein, His-tagged | +Inquiry |
SLC7A7-5237R | Recombinant Rat SLC7A7 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SLC7A7-1639HCL | Recombinant Human SLC7A7 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SLC7A7 Products
Required fields are marked with *
My Review for All SLC7A7 Products
Required fields are marked with *