Recombinant Human SLC7A7 protein, His-tagged

Cat.No. : SLC7A7-2525H
Product Overview : Recombinant Human SLC7A7 protein(459-511 aa), fused to His tag, was expressed in E. coli.
Availability September 18, 2026
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 459-511 aa
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole.
AA Sequence : LIIRVPEHKRPLYLRRIVGSATRYLQVLCMSVAAEMDLEDGGEMPKQRDPKSN
Purity : 95%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks).
Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
Reconstitution : Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.
Gene Name SLC7A7 solute carrier family 7 (amino acid transporter light chain, y+L system), member 7 [ Homo sapiens ]
Official Symbol SLC7A7
Synonyms SLC7A7; solute carrier family 7 (amino acid transporter light chain, y+L system), member 7; LPI; Y+L amino acid transporter 1; y+LAT 1; monocyte amino acid permease 2; y(+)L-type amino acid transporter 1; solute carrier family 7 (cationic amino acid transporter, y+ system), member 7; LAT3; MOP-2; Y+LAT1; y+LAT-1;
Gene ID 9056
mRNA Refseq NM_001126105
Protein Refseq NP_001119577
MIM 603593
UniProt ID Q9UM01

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All SLC7A7 Products

Required fields are marked with *

My Review for All SLC7A7 Products

Required fields are marked with *

0
cart-icon
0
compare icon