Recombinant Human SLC8A3 Protein, GST-tagged
Cat.No. : | SLC8A3-66H |
Product Overview : | Recombinant Human SLC8A3 Protein is produced by Wheat Germ (in vitro) expression system. This protein is fused with a GST tag at the N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Protein Length : | 1-284 a.a. |
Description : | This gene encodes a member of the sodium/calcium exchanger integral membrane protein family. Three mammalian isoforms in family 8 have been identified. Na+/Ca2+ exchange proteins are involved in maintaining Ca2+ homeostasis in a wide variety of cell types. The protein is regulated by intracellular calcium ions and is found in both the plasma membrane and intracellular organellar membranes, where exchange of Na+ for Ca2+ occurs in an electrogenic manner. Alternative splicing has been observed for this gene and multiple variants have been described. |
Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Molecular Mass : | 57.5 kDa |
AA Sequence : | MEEEEAKRIAEMGKPVLGEHPKLEVIIEESYEFKTTVDKLIKKTNLALVVGTHSWRDQFMEAITVSAAGDEDEDESGEERLPSCFDYVMHFLTVFWKVLFACVPPTEYCHGWACFAVSILIIGMLTAIIGDLASHFGCTIGLKDSVTAVVFVAFGTSVPDTFASKAAALQDVYADASIGNVTGSNAVNVFLGIGLAWSVAAIYWALQGQEFHVSAGTLAFSVTLFTIFAFVCISVLLYRRRPHLGGELGGPRGCKLATTWLFVSLWLLYILFATLEAYCYIKGF |
Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
◆ Recombinant Proteins | ||
SLC8A3-5525C | Recombinant Chicken SLC8A3 | +Inquiry |
SLC8A3-5242R | Recombinant Rat SLC8A3 Protein, His (Fc)-Avi-tagged | +Inquiry |
SLC8A3-6655Z | Recombinant Zebrafish SLC8A3 | +Inquiry |
SLC8A3-66H | Recombinant Human SLC8A3 Protein, GST-tagged | +Inquiry |
SLC8A3-5583R | Recombinant Rat SLC8A3 Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SLC8A3 Products
Required fields are marked with *
My Review for All SLC8A3 Products
Required fields are marked with *