Recombinant Human SLC9A9 protein, GST-tagged
Cat.No. : | SLC9A9-301569H |
Product Overview : | Recombinant Human SLC9A9 (481-645 aa) protein, fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | Thr481-Asn645 |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
AA Sequence : | TPMLTWLQIRVGVDLDENLKEDPSSQHQEANNLDKNMTKAESARLFRMWYSFDHKYLKPILTHSGPPLTTTLPEWCGPISRLLTSPQAYGEQLKEDDVECIVNQDELAINYQEQASSPCSPPARLGLDQKASPQTPGKENIYEGDLGLGGYELKLEQTLGQSQLN |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Stability : | Store for up to 12 months at -20°C to -80°C as lyophilized powder. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Gene Name | SLC9A9 solute carrier family 9, subfamily A (NHE9, cation proton antiporter 9), member 9 [ Homo sapiens ] |
Official Symbol | SLC9A9 |
Synonyms | SLC9A9; solute carrier family 9, subfamily A (NHE9, cation proton antiporter 9), member 9; solute carrier family 9 (sodium/hydrogen exchanger), isoform 9 , solute carrier family 9 (sodium/hydrogen exchanger), member 9; sodium/hydrogen exchanger 9; FLJ35613; NHE9; Na(+)/H(+) exchanger 9; sodium/proton exchanger NHE9; putative protein product of Nbla00118; solute carrier family 9 (sodium/hydrogen exchanger), isoform 9; AUTS16; |
Gene ID | 285195 |
mRNA Refseq | NM_173653 |
Protein Refseq | NP_775924 |
MIM | 608396 |
UniProt ID | Q8IVB4 |
◆ Recombinant Proteins | ||
SLC9A9-301569H | Recombinant Human SLC9A9 protein, GST-tagged | +Inquiry |
SLC9A9-15537M | Recombinant Mouse SLC9A9 Protein | +Inquiry |
SLC9A9-8435M | Recombinant Mouse SLC9A9 Protein, His (Fc)-Avi-tagged | +Inquiry |
SLC9A9-2961C | Recombinant Chicken SLC9A9 | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All SLC9A9 Products
Required fields are marked with *
My Review for All SLC9A9 Products
Required fields are marked with *
0
Inquiry Basket