Recombinant Human SLC9A9 protein, GST-tagged

Cat.No. : SLC9A9-301569H
Product Overview : Recombinant Human SLC9A9 (481-645 aa) protein, fused to GST tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : GST
Protein Length : Thr481-Asn645
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
AA Sequence : TPMLTWLQIRVGVDLDENLKEDPSSQHQEANNLDKNMTKAESARLFRMWYSFDHKYLKPILTHSGPPLTTTLPEWCGPISRLLTSPQAYGEQLKEDDVECIVNQDELAINYQEQASSPCSPPARLGLDQKASPQTPGKENIYEGDLGLGGYELKLEQTLGQSQLN
Purity : 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Stability : Store for up to 12 months at -20°C to -80°C as lyophilized powder.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks).
Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
Gene Name SLC9A9 solute carrier family 9, subfamily A (NHE9, cation proton antiporter 9), member 9 [ Homo sapiens ]
Official Symbol SLC9A9
Synonyms SLC9A9; solute carrier family 9, subfamily A (NHE9, cation proton antiporter 9), member 9; solute carrier family 9 (sodium/hydrogen exchanger), isoform 9 , solute carrier family 9 (sodium/hydrogen exchanger), member 9; sodium/hydrogen exchanger 9; FLJ35613; NHE9; Na(+)/H(+) exchanger 9; sodium/proton exchanger NHE9; putative protein product of Nbla00118; solute carrier family 9 (sodium/hydrogen exchanger), isoform 9; AUTS16;
Gene ID 285195
mRNA Refseq NM_173653
Protein Refseq NP_775924
MIM 608396
UniProt ID Q8IVB4

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All SLC9A9 Products

Required fields are marked with *

My Review for All SLC9A9 Products

Required fields are marked with *

0
cart-icon
0
compare icon