Recombinant Human SLC9A9 protein, GST-tagged

• Cat.No.: SLC9A9-301569H
• Product Overview: Recombinant Human SLC9A9 (481-645 aa) protein, fused to GST tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• Protein Length: Thr481-Asn645
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
• AA Sequence: TPMLTWLQIRVGVDLDENLKEDPSSQHQEANNLDKNMTKAESARLFRMWYSFDHKYLKPILTHSGPPLTTTLPEWCGPISRLLTSPQAYGEQLKEDDVECIVNQDELAINYQEQASSPCSPPARLGLDQKASPQTPGKENIYEGDLGLGGYELKLEQTLGQSQLN
• Purity: 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Stability: Store for up to 12 months at -20°C to -80°C as lyophilized powder.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.

Gene Information

• Gene Name: SLC9A9 solute carrier family 9, subfamily A (NHE9, cation proton antiporter 9), member 9 [ Homo sapiens ]
• Official Symbol: SLC9A9
• Synonyms: SLC9A9; solute carrier family 9, subfamily A (NHE9, cation proton antiporter 9), member 9; solute carrier family 9 (sodium/hydrogen exchanger), isoform 9 , solute carrier family 9 (sodium/hydrogen exchanger), member 9; sodium/hydrogen exchanger 9; FLJ35613; NHE9; Na(+)/H(+) exchanger 9; sodium/proton exchanger NHE9; putative protein product of Nbla00118; solute carrier family 9 (sodium/hydrogen exchanger), isoform 9; AUTS16
• Gene ID: 285195
• mRNA Refseq: NM_173653
• Protein Refseq: NP_775924
• MIM: 608396
• UniProt ID: Q8IVB4