Recombinant Human SLCO1A2 protein, GST-tagged

• Cat.No.: SLCO1A2-7143H
• Product Overview: Recombinant Human SLCO1A2 protein(406-513 aa), fused with N-terminal GST tag, was expressed in E.coli.

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• Protein Length: 406-513 aa
• Form: The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 8.0). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients.
• AASequence: FLMTCENSSVVGINTSYEGIPQDLYVENDIFADCNVDCNCPSKIWDPVCGNNGLSYLSACLAGCETSIGTGINMVFQNCSCIQTSGNSSAVLGLCDKGPDCSLMLQYF
• Purity: 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
• Reconstitution: Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution.

Gene Information

• Gene Name: SLCO1A2 solute carrier organic anion transporter family, member 1A2 [ Homo sapiens ]
• Official Symbol: SLCO1A2
• Synonyms: SLCO1A2; solute carrier organic anion transporter family, member 1A2; SLC21A3, solute carrier family 21 (organic anion transporter), member 3; solute carrier organic anion transporter family member 1A2; OATP; OATP A; OATP1A2; OATP-1; solute carrier family 21 member 3; organic anion transporting polypeptide A; organic anion-transporting polypeptide 1; sodium-independent organic anion transporter; solute carrier family 21 (organic anion transporter), member 3; OATP-A; SLC21A3
• Gene ID: 6579
• mRNA Refseq: NM_021094
• Protein Refseq: NP_066580
• MIM: 602883
• UniProt ID: P46721