Recombinant Human SLCO1A2 protein, GST-tagged
Cat.No. : | SLCO1A2-7143H |
Product Overview : | Recombinant Human SLCO1A2 protein(406-513 aa), fused with N-terminal GST tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 406-513 aa |
Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 8.0). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. |
AASequence : | FLMTCENSSVVGINTSYEGIPQDLYVENDIFADCNVDCNCPSKIWDPVCGNNGLSYLSACLAGCETSIGTGINMVFQNCSCIQTSGNSSAVLGLCDKGPDCSLMLQYF |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
Gene Name | SLCO1A2 solute carrier organic anion transporter family, member 1A2 [ Homo sapiens ] |
Official Symbol | SLCO1A2 |
Synonyms | SLCO1A2; solute carrier organic anion transporter family, member 1A2; SLC21A3, solute carrier family 21 (organic anion transporter), member 3; solute carrier organic anion transporter family member 1A2; OATP; OATP A; OATP1A2; OATP-1; solute carrier family 21 member 3; organic anion transporting polypeptide A; organic anion-transporting polypeptide 1; sodium-independent organic anion transporter; solute carrier family 21 (organic anion transporter), member 3; OATP-A; SLC21A3; |
Gene ID | 6579 |
mRNA Refseq | NM_021094 |
Protein Refseq | NP_066580 |
MIM | 602883 |
UniProt ID | P46721 |
◆ Recombinant Proteins | ||
SLCO1A2-5251R | Recombinant Rat SLCO1A2 Protein, His (Fc)-Avi-tagged | +Inquiry |
SLCO1A2-6311H | Recombinant Human SLCO1A2 Protein (Phe406-Phe513), N-His tagged | +Inquiry |
SLCO1A2-4318R | Recombinant Rhesus monkey SLCO1A2 Protein, His-tagged | +Inquiry |
SLCO1A2-7143H | Recombinant Human SLCO1A2 protein, GST-tagged | +Inquiry |
SLCO1A2-5592R | Recombinant Rat SLCO1A2 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
SLCO1A2-1690HCL | Recombinant Human SLCO1A2 293 Cell Lysate | +Inquiry |
SLCO1A2-1691HCL | Recombinant Human SLCO1A2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SLCO1A2 Products
Required fields are marked with *
My Review for All SLCO1A2 Products
Required fields are marked with *