Recombinant Human SLCO1B1 Protein, GST-tagged

Cat.No. : SLCO1B1-27769TH
Product Overview : Recombinant Human SLCO1B1(481 a.a. - 570 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Protein Length : 481 a.a. - 570 a.a.
Description : This gene encodes a liver-specific member of the organic anion transporter family. The encoded protein is a transmembrane receptor that mediates the sodium-independent uptake of numerous endogenous compounds including bilirubin, 17-beta-glucuronosyl estradiol and leukotriene C4. This protein is also involved in the removal of drug compounds such as statins, bromosulfophthalein and rifampin from the blood into the hepatocytes. Polymorphisms in the gene encoding this protein are associated with impaired transporter function.
Form : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass : 35.64 kDa
AA Sequence : YISPCLAGCKSSSGNKKPIVFYNCSCLEVTGLQNRNYSAHLGECPRDDACTRKFYFFVAIQVLNLFFSALGGTSHVMLIVKIVQPELKSL
Applications : Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Gene Name SLCO1B1 solute carrier organic anion transporter family, member 1B1 [ Homo sapiens ]
Official Symbol SLCO1B1
Synonyms SLCO1B1; solute carrier organic anion transporter family, member 1B1; SLC21A6, solute carrier family 21 (organic anion transporter), member 6; solute carrier organic anion transporter family member 1B1; LST 1; OATP C; OATP1B1; OATP-2; solute carrier family 21 member 6; liver-specific organic anion transporter 1; sodium-independent organic anion-transporting polypeptide 2; solute carrier family 21 (organic anion transporter), member 6; LST1; HBLRR; LST-1; OATP2; OATPC; OATP-C; SLC21A6; MGC133282;
Gene ID 10599
mRNA Refseq NM_006446
Protein Refseq NP_006437
MIM 604843
UniProt ID Q9Y6L6

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All SLCO1B1 Products

Required fields are marked with *

My Review for All SLCO1B1 Products

Required fields are marked with *

0
cart-icon