Recombinant Human SLCO1B1 Protein, GST-tagged
| Cat.No. : | SLCO1B1-27769TH |
| Product Overview : | Recombinant Human SLCO1B1(481 a.a. - 570 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Protein Length : | 481 a.a. - 570 a.a. |
| Description : | This gene encodes a liver-specific member of the organic anion transporter family. The encoded protein is a transmembrane receptor that mediates the sodium-independent uptake of numerous endogenous compounds including bilirubin, 17-beta-glucuronosyl estradiol and leukotriene C4. This protein is also involved in the removal of drug compounds such as statins, bromosulfophthalein and rifampin from the blood into the hepatocytes. Polymorphisms in the gene encoding this protein are associated with impaired transporter function. |
| Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Molecular Mass : | 35.64 kDa |
| AA Sequence : | YISPCLAGCKSSSGNKKPIVFYNCSCLEVTGLQNRNYSAHLGECPRDDACTRKFYFFVAIQVLNLFFSALGGTSHVMLIVKIVQPELKSL |
| Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Gene Name | SLCO1B1 solute carrier organic anion transporter family, member 1B1 [ Homo sapiens ] |
| Official Symbol | SLCO1B1 |
| Synonyms | SLCO1B1; solute carrier organic anion transporter family, member 1B1; SLC21A6, solute carrier family 21 (organic anion transporter), member 6; solute carrier organic anion transporter family member 1B1; LST 1; OATP C; OATP1B1; OATP-2; solute carrier family 21 member 6; liver-specific organic anion transporter 1; sodium-independent organic anion-transporting polypeptide 2; solute carrier family 21 (organic anion transporter), member 6; LST1; HBLRR; LST-1; OATP2; OATPC; OATP-C; SLC21A6; MGC133282; |
| Gene ID | 10599 |
| mRNA Refseq | NM_006446 |
| Protein Refseq | NP_006437 |
| MIM | 604843 |
| UniProt ID | Q9Y6L6 |
| ◆ Recombinant Proteins | ||
| SLCO1B1-0669H | Recombinant Human SLCO1B1 Protein (D2-C691), 8×His-MBP, Flag tagged | +Inquiry |
| SLCO1B1-27769TH | Recombinant Human SLCO1B1 Protein, GST-tagged | +Inquiry |
| SLCO1B1-683C | Recombinant Cynomolgus Monkey SLCO1B1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| SLCO1B1-940C | Recombinant Cynomolgus SLCO1B1 Protein, His-tagged | +Inquiry |
| SLCO1B1-5562H | Recombinant Human SLCO1B1 Protein (Phe426-Phe537), N-His tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| SLCO1B1-1689HCL | Recombinant Human SLCO1B1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SLCO1B1 Products
Required fields are marked with *
My Review for All SLCO1B1 Products
Required fields are marked with *
