Recombinant Human SLCO4C1 Protein, His-tagged
Cat.No. : | SLCO4C1-7843H |
Product Overview : | Recombinant Human SLCO4C1 Protein(1-105 aa), fused with N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Tag : | His |
Protein Length : | 1-105 aa |
Tag : | N-His |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 μg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage. |
AA Sequence : | MKSAKGIENLAFVPSSPDILRRLSASPSQIEVSALSSDPQRENSQPQELQKPQEPQKSPEPSLPSAPPNVSEEKLRSLSLSEFEEGSYGWRNFHPQCLQRCNTPG |
Gene Name | SLCO4C1 solute carrier organic anion transporter family, member 4C1 [ Homo sapiens ] |
Official Symbol | SLCO4C1 |
Synonyms | SLCO4C1; solute carrier organic anion transporter family, member 4C1; solute carrier organic anion transporter family member 4C1; OATP H; OATP4C1; OATPX; SLC21A20; organic anion transporter M1; solute carrier family 21 member 20; OATP-H; OATP-M1; PRO2176; |
Gene ID | 353189 |
mRNA Refseq | NM_180991 |
Protein Refseq | NP_851322 |
MIM | 609013 |
UniProt ID | Q6ZQN7 |
◆ Recombinant Proteins | ||
SLCO4C1-15548M | Recombinant Mouse SLCO4C1 Protein | +Inquiry |
SLCO4C1-5258R | Recombinant Rat SLCO4C1 Protein, His (Fc)-Avi-tagged | +Inquiry |
SLCO4C1-8442M | Recombinant Mouse SLCO4C1 Protein, His (Fc)-Avi-tagged | +Inquiry |
SLCO4C1-7843H | Recombinant Human SLCO4C1 Protein, His-tagged | +Inquiry |
SLCO4C1-5599R | Recombinant Rat SLCO4C1 Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SLCO4C1 Products
Required fields are marked with *
My Review for All SLCO4C1 Products
Required fields are marked with *