Recombinant Human SLCO5A1 protein, His-tagged

• Cat.No.: SLCO5A1-2998H
• Product Overview: Recombinant Human SLCO5A1 protein(1-128 aa), fused to His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 1-128 aa
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole.
• AA Sequence: MDEGTGLQPGAGEQLEAPATAEAVQERCEPETLRSKSLPVLSSASCRPSLSPTSGDANPAFGCVDSSGHQELKQGPNPLAPSPSAPSTSAGLGDCNHRVDLSKTFSVSSALAMLQERRCLYVVLTDSR
• Purity: 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
• Reconstitution: Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
  Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.

Gene Information

• Gene Name: SLCO5A1 solute carrier organic anion transporter family, member 5A1 [ Homo sapiens ]
• Official Symbol: SLCO5A1
• Synonyms: SLCO5A1; solute carrier organic anion transporter family, member 5A1; SLC21A15, solute carrier family 21 (organic anion transporter), member 15; solute carrier organic anion transporter family member 5A1; OATP J; OATP5A1; OATPRP4; solute carrier family 21 member 15; organic anion transporter polypeptide-related protein 4; solute carrier family 21 (organic anion transporter), member 15; OATP-J; OATP-RP4; SLC21A15; FLJ39560
• Gene ID: 81796
• mRNA Refseq: NM_001146008
• Protein Refseq: NP_001139480
• MIM: 613543
• UniProt ID: Q9H2Y9