Recombinant Human SLCO5A1 protein, His-tagged
| Cat.No. : | SLCO5A1-2998H |
| Product Overview : | Recombinant Human SLCO5A1 protein(1-128 aa), fused to His tag, was expressed in E. coli. |
| Availability | September 24, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 1-128 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
| AA Sequence : | MDEGTGLQPGAGEQLEAPATAEAVQERCEPETLRSKSLPVLSSASCRPSLSPTSGDANPAFGCVDSSGHQELKQGPNPLAPSPSAPSTSAGLGDCNHRVDLSKTFSVSSALAMLQERRCLYVVLTDSR |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
| Gene Name | SLCO5A1 solute carrier organic anion transporter family, member 5A1 [ Homo sapiens ] |
| Official Symbol | SLCO5A1 |
| Synonyms | SLCO5A1; solute carrier organic anion transporter family, member 5A1; SLC21A15, solute carrier family 21 (organic anion transporter), member 15; solute carrier organic anion transporter family member 5A1; OATP J; OATP5A1; OATPRP4; solute carrier family 21 member 15; organic anion transporter polypeptide-related protein 4; solute carrier family 21 (organic anion transporter), member 15; OATP-J; OATP-RP4; SLC21A15; FLJ39560; |
| Gene ID | 81796 |
| mRNA Refseq | NM_001146008 |
| Protein Refseq | NP_001139480 |
| MIM | 613543 |
| UniProt ID | Q9H2Y9 |
| ◆ Recombinant Proteins | ||
| SLCO5A1-2998H | Recombinant Human SLCO5A1 protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SLCO5A1 Products
Required fields are marked with *
My Review for All SLCO5A1 Products
Required fields are marked with *
