Recombinant Human SLCO5A1 protein, His-tagged

Cat.No. : SLCO5A1-2998H
Product Overview : Recombinant Human SLCO5A1 protein(1-128 aa), fused to His tag, was expressed in E. coli.
Availability August 08, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 1-128 aa
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole.
AA Sequence : MDEGTGLQPGAGEQLEAPATAEAVQERCEPETLRSKSLPVLSSASCRPSLSPTSGDANPAFGCVDSSGHQELKQGPNPLAPSPSAPSTSAGLGDCNHRVDLSKTFSVSSALAMLQERRCLYVVLTDSR
Purity : 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks).
Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
Reconstitution : Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.
Gene Name SLCO5A1 solute carrier organic anion transporter family, member 5A1 [ Homo sapiens ]
Official Symbol SLCO5A1
Synonyms SLCO5A1; solute carrier organic anion transporter family, member 5A1; SLC21A15, solute carrier family 21 (organic anion transporter), member 15; solute carrier organic anion transporter family member 5A1; OATP J; OATP5A1; OATPRP4; solute carrier family 21 member 15; organic anion transporter polypeptide-related protein 4; solute carrier family 21 (organic anion transporter), member 15; OATP-J; OATP-RP4; SLC21A15; FLJ39560;
Gene ID 81796
mRNA Refseq NM_001146008
Protein Refseq NP_001139480
MIM 613543
UniProt ID Q9H2Y9

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All SLCO5A1 Products

Required fields are marked with *

My Review for All SLCO5A1 Products

Required fields are marked with *

0
cart-icon