Recombinant Human SLIT1 protein, His-tagged
Cat.No. : | SLIT1-7837H |
Product Overview : | Recombinant Human SLIT1 protein(1342-1503 aa), fused with N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1342-1503 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
AA Sequence : | CRKLYCLHGICQPNATPGPMCHCEAGWVGLHCDQPADGPCHGHKCVHGQCVPLDALSYSCQCQDGYSGALCNQAGALAEPCRGLQCLHGHCQASGTKGAHCVCDPGFSGELCEQESECRGDPVRDFHQVQRGYAICQTTRPLSWVECRGSCPGQGCCQGLRL |
Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Official Symbol | SLIT1 |
Synonyms | SLIT1; slit homolog 1 (Drosophila); SLIL1, slit (Drosophila) homolog 1; slit homolog 1 protein; MEGF4; Slit 1; slit1; SLIT3; multiple EGF-like domains protein 4; multiple epidermal growth factor-like domains protein 4; SLIL1; SLIT-1; MGC164811; |
Gene ID | 6585 |
mRNA Refseq | NM_003061 |
Protein Refseq | NP_003052 |
MIM | 603742 |
UniProt ID | O75093 |
◆ Recombinant Proteins | ||
SLIT1-5260R | Recombinant Rat SLIT1 Protein, His (Fc)-Avi-tagged | +Inquiry |
SLIT1-19H | Active Recombinant Human Slit1, His-tagged | +Inquiry |
SLIT1-5601R | Recombinant Rat SLIT1 Protein | +Inquiry |
SLIT1-8445M | Recombinant Mouse SLIT1 Protein, His (Fc)-Avi-tagged | +Inquiry |
SLIT1-7836H | Recombinant Human SLIT1 protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SLIT1 Products
Required fields are marked with *
My Review for All SLIT1 Products
Required fields are marked with *
0
Inquiry Basket