Recombinant Human SLPI protein, His-tagged

Cat.No. : SLPI-5863H
Product Overview : Recombinant Human SLPI protein(24-132 aa), fused with N-terminal His tag, was expressed in E.coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 24-132 aa
Form : The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 7.4). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients.
AASequence : EGSGKSFKAGVCPPKKSAQCLRYKKPECQSDWQCPGKKRCCPDTCGIKCLDPVDTPNPTRRKPGKCPVTYGQCLMLNPPNFCEMDGQCKRDLKCCMGMCGKSCVSPVKA
Purity : 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage : Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
Reconstitution : Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution.
Gene Name SLPI secretory leukocyte peptidase inhibitor [ Homo sapiens ]
Official Symbol SLPI
Synonyms SLPI; secretory leukocyte peptidase inhibitor; secretory leukocyte protease inhibitor (antileukoproteinase); antileukoproteinase; ALK1; ALP; BLPI; HUSI; HUSI I; WAP4; WFDC4; HUSI-1; protease inhibitor WAP4; mucus proteinase inhibitor; seminal proteinase inhibitor; WAP four-disulfide core domain protein 4; MPI; HUSI-I;
Gene ID 6590
mRNA Refseq NM_003064
Protein Refseq NP_003055
MIM 107285
UniProt ID P03973

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All SLPI Products

Required fields are marked with *

My Review for All SLPI Products

Required fields are marked with *

0
cart-icon
0
compare icon