Recombinant Human SLPI protein, His-tagged
Cat.No. : | SLPI-5863H |
Product Overview : | Recombinant Human SLPI protein(24-132 aa), fused with N-terminal His tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 24-132 aa |
Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 7.4). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. |
AASequence : | EGSGKSFKAGVCPPKKSAQCLRYKKPECQSDWQCPGKKRCCPDTCGIKCLDPVDTPNPTRRKPGKCPVTYGQCLMLNPPNFCEMDGQCKRDLKCCMGMCGKSCVSPVKA |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
Gene Name | SLPI secretory leukocyte peptidase inhibitor [ Homo sapiens ] |
Official Symbol | SLPI |
Synonyms | SLPI; secretory leukocyte peptidase inhibitor; secretory leukocyte protease inhibitor (antileukoproteinase); antileukoproteinase; ALK1; ALP; BLPI; HUSI; HUSI I; WAP4; WFDC4; HUSI-1; protease inhibitor WAP4; mucus proteinase inhibitor; seminal proteinase inhibitor; WAP four-disulfide core domain protein 4; MPI; HUSI-I; |
Gene ID | 6590 |
mRNA Refseq | NM_003064 |
Protein Refseq | NP_003055 |
MIM | 107285 |
UniProt ID | P03973 |
◆ Recombinant Proteins | ||
SLPI-5643H | Recombinant Human SLPI protein, hFc-tagged | +Inquiry |
SLPI-6313H | Recombinant Human SLPI Protein (Ser26-Ala132), N-GST tagged | +Inquiry |
SLPI-15575M | Recombinant Mouse Slpi protein, His-tagged | +Inquiry |
SLPI-2036H | Recombinant Human SLPI Protein, His (Fc)-Avi-tagged | +Inquiry |
SLPI-5863H | Recombinant Human SLPI protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SLPI-001HCL | Recombinant Human SLPI cell lysate | +Inquiry |
SLPI-530HCL | Recombinant Human SLPI cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SLPI Products
Required fields are marked with *
My Review for All SLPI Products
Required fields are marked with *