Recombinant Human SLPI Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : SLPI-2349H
Product Overview : SLPI MS Standard C13 and N15-labeled recombinant protein (NP_003055) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : This gene encodes a secreted inhibitor which protects epithelial tissues from serine proteases. It is found in various secretions including seminal plasma, cervical mucus, and bronchial secretions, and has affinity for trypsin, leukocyte elastase, and cathepsin G. Its inhibitory effect contributes to the immune response by protecting epithelial surfaces from attack by endogenous proteolytic enzymes. This antimicrobial protein has antibacterial, antifungal and antiviral activity.
Molecular Mass : 14.3 kDa
AA Sequence : MKSSGLFPFLVLLALGTLAPWAVEGSGKSFKAGVCPPKKSAQCLRYKKPECQSDWQCPGKKRCCPDTCGIKCLDPVDTPNPTRRKPGKCPVTYGQCLMLNPPNFCEMDGQCKRDLKCCMGMCGKSCVSPVKATRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name SLPI secretory leukocyte peptidase inhibitor [ Homo sapiens (human) ]
Official Symbol SLPI
Synonyms SLPI; secretory leukocyte peptidase inhibitor; secretory leukocyte protease inhibitor (antileukoproteinase); antileukoproteinase; ALK1; ALP; BLPI; HUSI; HUSI I; WAP4; WFDC4; HUSI-1; protease inhibitor WAP4; mucus proteinase inhibitor; seminal proteinase inhibitor; WAP four-disulfide core domain protein 4; MPI; HUSI-I;
Gene ID 6590
mRNA Refseq NM_003064
Protein Refseq NP_003055
MIM 107285
UniProt ID P03973

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All SLPI Products

Required fields are marked with *

My Review for All SLPI Products

Required fields are marked with *

0

Inquiry Basket

cartIcon