Recombinant Human SLX1B Protein, GST-tagged
Cat.No. : | SLX1B-4920H |
Product Overview : | Human GIYD2 full-length ORF ( NP_076949.1, 1 a.a. - 275 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes a protein that is an important regulator of genome stability. The protein represents the catalytic subunit of the SLX1-SLX4 structure-specific endonuclease, which can resolve DNA secondary structures that are formed during repair and recombination processes. Two identical copies of this gene are located on the p arm of chromosome 16 due to a segmental duplication; this record represents the more telomeric copy. Alternative splicing results in multiple transcript variants. Read-through transcription also occurs between this gene and the downstream SULT1A4 (sulfotransferase family, cytosolic, 1A, phenol-preferring, member 4) gene. [provided by RefSeq, Nov 2010] |
Molecular Mass : | 57.2 kDa |
AA Sequence : | MGPAGVAARPGRFFGVYLLYCLNPRYRGRVYVGFTVNTARRVQQHNGGRKKGGAWRTSGRGPWEMVLVVHGFPSSVAALRFEWAWQHPHASRRLAHVGPRLRGETAFAFHLRVLAHMLRAPPWARLPLTLRWVRPDLRQDLCLPPPPHVPLAFGPPPPQAPAPRRRAGPFDDAEPEPDQGDPGACCSLCAQTIQDEEGPLCCPHPGCLLRAHVICLAEEFLQEEPGQLLPLEGQCPCCEKSLLWGDLIWLCQMDTEKEVEDSELEEAHWTDLLET |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | SLX1B SLX1 homolog B, structure-specific endonuclease subunit [ Homo sapiens (human) ] |
Official Symbol | SLX1B |
Synonyms | SLX1B; SLX1 homolog B, structure-specific endonuclease subunit; GIYD2; structure-specific endonuclease subunit SLX1; GIY-YIG domain-containing protein 1; SLX1 structure-specific endonuclease subunit homolog B |
Gene ID | 79008 |
mRNA Refseq | NM_024044 |
Protein Refseq | NP_076949 |
MIM | 615823 |
UniProt ID | Q9BQ83 |
◆ Recombinant Proteins | ||
SLX1B-5265R | Recombinant Rat SLX1B Protein, His (Fc)-Avi-tagged | +Inquiry |
SLX1B-4144R | Recombinant Rhesus Macaque SLX1B Protein, His (Fc)-Avi-tagged | +Inquiry |
SLX1B-5289HF | Recombinant Full Length Human SLX1B Protein, GST-tagged | +Inquiry |
SLX1B-4328R | Recombinant Rhesus monkey SLX1B Protein, His-tagged | +Inquiry |
SLX1B-5606R | Recombinant Rat SLX1B Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
SLX1B-5924HCL | Recombinant Human GIYD2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All SLX1B Products
Required fields are marked with *
My Review for All SLX1B Products
Required fields are marked with *
0
Inquiry Basket