Recombinant Human SLX4 protein, His-tagged

• Cat.No.: SLX4-6757H
• Product Overview: Recombinant Human SLX4 protein, fused with N-terminal His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E. coli
• Tag: His
• Form: The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 7.4). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 300 mM imidazole.
• AASequence: ELRQNGLRVSSRRLLDFLDTHCITFTTAATRREKLQGRRRQPRGKKKVERN
• Purity: 85%, by SDS-PAGE.
• Storage: Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
• Reconstitution: It is recommended that sterile water be added to the vial to prepare a stock solution of 0.25 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.

Gene Information

• Gene Name: SLX4 SLX4 structure-specific endonuclease subunit homolog (S. cerevisiae) [ Homo sapiens ]
• Official Symbol: SLX4
• Synonyms: SLX4; SLX4 structure-specific endonuclease subunit homolog (S. cerevisiae); BTB (POZ) domain containing 12 , BTBD12; structure-specific endonuclease subunit SLX4; Fanconi anemia; complementation group P; FANCP; KIAA1784; KIAA1987; BTB (POZ) domain containing 12; BTB/POZ domain-containing protein 12; BTBD12; MUS312
• mRNA Refseq: NM_032444
• Protein Refseq: NP_115820
• MIM: 613278
• UniProt ID: Q8IY92
• Gene ID: 84464