Recombinant Human SLX4 protein, His-tagged
Cat.No. : | SLX4-6757H |
Product Overview : | Recombinant Human SLX4 protein, fused with N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E. coli |
Tag : | His |
Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 7.4). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 300 mM imidazole. |
AASequence : | ELRQNGLRVSSRRLLDFLDTHCITFTTAATRREKLQGRRRQPRGKKKVERN |
Purity : | 85%, by SDS-PAGE. |
Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.25 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
Gene Name | SLX4 SLX4 structure-specific endonuclease subunit homolog (S. cerevisiae) [ Homo sapiens ] |
Official Symbol | SLX4 |
Synonyms | SLX4; SLX4 structure-specific endonuclease subunit homolog (S. cerevisiae); BTB (POZ) domain containing 12 , BTBD12; structure-specific endonuclease subunit SLX4; Fanconi anemia; complementation group P; FANCP; KIAA1784; KIAA1987; BTB (POZ) domain containing 12; BTB/POZ domain-containing protein 12; BTBD12; MUS312; |
mRNA Refseq | NM_032444 |
Protein Refseq | NP_115820 |
MIM | 613278 |
UniProt ID | Q8IY92 |
Gene ID | 84464 |
◆ Recombinant Proteins | ||
SLX4-15581M | Recombinant Mouse SLX4 Protein | +Inquiry |
SLX4-6755H | Recombinant Human SLX4 protein, His-tagged | +Inquiry |
SLX4-6756H | Recombinant Human SLX4 protein, GST-tagged | +Inquiry |
SLX4-8455M | Recombinant Mouse SLX4 Protein, His (Fc)-Avi-tagged | +Inquiry |
SLX4-6757H | Recombinant Human SLX4 protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SLX4-188HCL | Recombinant Human SLX4 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All SLX4 Products
Required fields are marked with *
My Review for All SLX4 Products
Required fields are marked with *
0
Inquiry Basket