Recombinant Human SMAP1 Protein, Myc/DDK-tagged, C13 and N15-labeled
| Cat.No. : | SMAP1-5333H |
| Product Overview : | SMAP1 MS Standard C13 and N15-labeled recombinant protein (NP_068759) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | DDK&Myc |
| Description : | The protein encoded by this gene is similar to the mouse stromal membrane-associated protein-1. This similarity suggests that this human gene product is also a type II membrane glycoprotein involved in the erythropoietic stimulatory activity of stromal cells. Alternate splicing results in multiple transcript variants encoding different isoforms. |
| Molecular Mass : | 48.1 kDa |
| AA Sequence : | MATRSCREKAQKLNEQHQLILSKLLREEDNKYCADCEAKGPRWASWNIGVFICIRCAGIHRNLGVHISRVKSVNLDQWTAEQIQCMQDMGNTKARLLYEANLPENFRRPQTDQAVEFFIRDKYEKKKYYDKNAIAITNKEKEKKKEEKKREKEPEKPAKPLTAEKLQKKDQQLEPKKSTSPKKAAEPTVDLLGLDGPAVAPVTNGNTTVPPLNDDLDIFGPMISNPLPATVMPPAQGTPSAPAAATLSTVTSGDLDLFTEQTTKSEEVAKKQLSKDSILSLYGTGTIQQQSTPGVFMGPTNIPFTSQAPAAFQGFPSMGVPVPAAPGLIGNVMGQSPSMMVGMPMPNGFMGNAQTGVMPLPQNVVGPQGGMVGQMGAPQSKFGLPQAQQPQWSLSQMNQQMAGMSISSATPTAGFGQPSSTTAGWSGSSSGQTLSTQLWKTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
| Concentration : | 50 μg/mL as determined by BCA |
| Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
| Gene Name | SMAP1 small ArfGAP 1 [ Homo sapiens (human) ] |
| Official Symbol | SMAP1 |
| Synonyms | SMAP1; small ArfGAP 1; stromal membrane associated GTPase activating protein 1, stromal membrane associated protein 1; stromal membrane-associated protein 1; FLJ13159; SMAP 1; stromal membrane-associated GTPase-activating protein 1; SMAP-1; FLJ42245; |
| Gene ID | 60682 |
| mRNA Refseq | NM_021940 |
| Protein Refseq | NP_068759 |
| MIM | 611372 |
| UniProt ID | Q8IYB5 |
| ◆ Recombinant Proteins | ||
| SMAP1-2803H | Recombinant Human SMAP1, GST-tagged | +Inquiry |
| SMAP1-8460M | Recombinant Mouse SMAP1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| Smap1-5957M | Recombinant Mouse Smap1 Protein, Myc/DDK-tagged | +Inquiry |
| SMAP1-4854Z | Recombinant Zebrafish SMAP1 | +Inquiry |
| SMAP1-205H | Recombinant Human SMAP1 Protein, MYC/DDK-tagged, C13 and N15-labeled | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| SMAP1-1674HCL | Recombinant Human SMAP1 293 Cell Lysate | +Inquiry |
| SMAP1-1673HCL | Recombinant Human SMAP1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SMAP1 Products
Required fields are marked with *
My Review for All SMAP1 Products
Required fields are marked with *
