Recombinant Human SMARCB1 protein, GST-tagged
| Cat.No. : | SMARCB1-3763H |
| Product Overview : | Recombinant Human SMARCB1 protein(1-110 aa), fused to GST tag, was expressed in E. coli. |
| Availability | August 19, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | 1-110 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 100mM GSH. |
| AA Sequence : | MAKHHPDLIFCRKQAGVAIGRLCEKCDGKCVICDSYVRPCTLVRICDECNYGSYQGRCVICGGPGVSDAYYCKECTIQEKDRDGCPKIVNLGSSKTDLFYERKKYGFKKR |
| Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
| Gene Name | SMARCB1 SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily b, member 1 [ Homo sapiens ] |
| Official Symbol | SMARCB1 |
| Synonyms | SMARCB1; SNF5L1; BAF47; hSNFS; Ini1; RDT; Sfh1p; Snr1; yeast; homolog like 1; hSNF5; SNF5 homolog; INI1; SNF5; RTPS1; |
| Gene ID | 6598 |
| mRNA Refseq | NM_001007468.1 |
| Protein Refseq | NP_001007469.1 |
| MIM | 601607 |
| UniProt ID | Q12824 |
| ◆ Recombinant Proteins | ||
| SMARCB1-4337R | Recombinant Rhesus monkey SMARCB1 Protein, His-tagged | +Inquiry |
| SMARCB1-1013H | Recombinant Human SMARCB1 Protein (2-376 aa), His-SUMO-tagged | +Inquiry |
| SMARCB1-1910H | Recombinant Human SMARCB1 Protein, MYC/DDK-tagged | +Inquiry |
| SMARCB1-4153R | Recombinant Rhesus Macaque SMARCB1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| SMARCB1-1660H | Recombinant Human SMARCB1 Protein (2-376 aa), His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| SMARCB1-1647HCL | Recombinant Human SMARCB1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SMARCB1 Products
Required fields are marked with *
My Review for All SMARCB1 Products
Required fields are marked with *



