Recombinant Human SMARCB1 protein, GST-tagged

Cat.No. : SMARCB1-3763H
Product Overview : Recombinant Human SMARCB1 protein(1-110 aa), fused to GST tag, was expressed in E. coli.
Availability January 31, 2026
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : GST
Protein Length : 1-110 aa
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 100mM GSH.
AA Sequence : MAKHHPDLIFCRKQAGVAIGRLCEKCDGKCVICDSYVRPCTLVRICDECNYGSYQGRCVICGGPGVSDAYYCKECTIQEKDRDGCPKIVNLGSSKTDLFYERKKYGFKKR
Purity : 95%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks).
Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
Reconstitution : Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.
Gene Name SMARCB1 SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily b, member 1 [ Homo sapiens ]
Official Symbol SMARCB1
Synonyms SMARCB1; SNF5L1; BAF47; hSNFS; Ini1; RDT; Sfh1p; Snr1; yeast; homolog like 1; hSNF5; SNF5 homolog; INI1; SNF5; RTPS1;
Gene ID 6598
mRNA Refseq NM_001007468.1
Protein Refseq NP_001007469.1
MIM 601607
UniProt ID Q12824

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All SMARCB1 Products

Required fields are marked with *

My Review for All SMARCB1 Products

Required fields are marked with *

0
cart-icon
0
compare icon