Recombinant Human SMARCC1 Protein (449-669 aa), His-tagged
Cat.No. : | SMARCC1-2741H |
Product Overview : | Recombinant Human SMARCC1 Protein (449-669 aa) is produced by Baculovirus expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Neuroscience. Protein Description: Partial. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Insect Cells |
Tag : | His |
Protein Length : | 449-669 aa |
Description : | Involved in transcriptional activation and repression of select genes by chromatin rodeling (alteration of DNA-nucleosome topology). May stimulate the ATPase activity of the catalytic subunit of the complex. Belongs to the neural progenitors-specific chromatin rodeling complex (npBAF complex) and the neuron-specific chromatin rodeling complex (nBAF complex). During neural development a switch from a st/progenitor to a post-mitotic chromatin rodeling mechanism occurs as neurons exit the cell cycle and become committed to their adult state. The transition from proliferating neural st/progenitor cells to post-mitotic neurons requires a switch in subunit composition of the npBAF and nBAF complexes. As neural progenitors exit mitosis and differentiate into neurons, npBAF complexes which contain ACTL6A/BAF53A and PHF10/BAF45A, are exchanged for homologous alternative ACTL6B/BAF53B and DPF1/BAF45B or DPF3/BAF45C subunits in neuron-specific complexes (nBAF). The npBAF complex is essential for the self-renewal/proliferative capacity of the multipotent neural st cells. The nBAF complex along with CREST plays a role regulating the activity of genes essential for dendrite growth. |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 27.4 kDa |
AA Sequence : | IIIPSYASWFDYNCIHVIERRALPEFFNGKNKSKTPEIYLAYRNFMIDTYRLNPQEYLTSTACRRNLTGDVCAVMRVHAFLEQWGLVNYQVDPESRPMAMGPPPTPHFNVLADTPSGLVPLHLRSPQVPAAQQMLNFPEKNKEKPVDLQNFGLRTDIYSKKTLAKSKGASAGREWTEQETLLLLEALEMYKDDWNKVSEHVGSRTQDECILHFLRLPIEDP |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA will be sent along with the products. Please refer to it for detailed information. |
Gene Name | SMARCC1 SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily c, member 1 [ Homo sapiens ] |
Official Symbol | SMARCC1 |
Synonyms | SMARCC1; BAF155; CRACC1; Rsc8; SRG3; BRG1-associated factor 155; SWI3; |
Gene ID | 6599 |
mRNA Refseq | NM_003074 |
Protein Refseq | NP_003065 |
MIM | 601732 |
UniProt ID | Q92922 |
◆ Recombinant Proteins | ||
SMARCC1-4641H | Recombinant Human SMARCC1 protein, His-SUMO-tagged | +Inquiry |
Smarcc1-5961M | Recombinant Mouse Smarcc1 Protein, Myc/DDK-tagged | +Inquiry |
SMARCC1-2741H | Recombinant Human SMARCC1 Protein (449-669 aa), His-tagged | +Inquiry |
SMARCC1-2348H | Recombinant Human SMARCC1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
SMARCC1-1068H | Recombinant Human SMARCC1 Protein (449-669 aa), His-SUMO-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All SMARCC1 Products
Required fields are marked with *
My Review for All SMARCC1 Products
Required fields are marked with *
0
Inquiry Basket