Recombinant Human SMCO4 Protein, Myc/DDK-tagged, C13 and N15-labeled
| Cat.No. : | SMCO4-4084H |
| Product Overview : | C11orf75 MS Standard C13 and N15-labeled recombinant protein (NP_064564) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | DDK&Myc |
| Description : | SMCO4 (Single-Pass Membrane Protein With Coiled-Coil Domains 4) is a Protein Coding gene. Diseases associated with SMCO4 include Febrile Seizures, Familial, 1 and Familial Febrile Seizures. |
| Molecular Mass : | 6.7 kDa |
| AA Sequence : | MRQLKGKPKKETSKDKKERKQAMQEARQQITTVVLPTLAVVVLLIVVFVYVATRPTITETRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
| Concentration : | 50 μg/mL as determined by BCA |
| Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
| Gene Name | SMCO4 single-pass membrane protein with coiled-coil domains 4 [ Homo sapiens (human) ] |
| Official Symbol | SMCO4 |
| Synonyms | SMCO4; single-pass membrane protein with coiled-coil domains 4; FN5; C11orf75; single-pass membrane and coiled-coil domain-containing protein 4; UPF0443 protein C11orf75 |
| Gene ID | 56935 |
| mRNA Refseq | NM_020179 |
| Protein Refseq | NP_064564 |
| MIM | 609477 |
| UniProt ID | Q9NRQ5 |
| ◆ Recombinant Proteins | ||
| SMCO4-8455Z | Recombinant Zebrafish SMCO4 | +Inquiry |
| SMCO4-4084H | Recombinant Human SMCO4 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| Smco4-5966M | Recombinant Mouse Smco4 Protein, Myc/DDK-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| SMCO4-8334HCL | Recombinant Human C11orf75 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SMCO4 Products
Required fields are marked with *
My Review for All SMCO4 Products
Required fields are marked with *
