Recombinant Human SMG1 Protein, 2922-3031, N-GST tagged

• Cat.No.: SMG1-13H
• Product Overview: Human SMG1 partial ORF (NP_055535, 2922-3031) recombinant protein with GST-tag at N-terminal was expressed in Wheat Germ (in vitro).

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Protein Length: 2922-3031
• Description: This gene encodes a protein involved in nonsense-mediated mRNA decay (NMD) as part of the mRNA surveillance complex. The protein has kinase activity and is thought to function in NMD by phosphorylating the regulator of nonsense transcripts 1 protein. Alternatively spliced transcript variants have been described, but their full-length nature has yet to be determined.
• Molecular Mass: 37.84 kDa
• AA Sequence: PDVMSQNARKLIQKNLATSADTPPSTVPGTGKSVACSPKKAVRDPKTGKAVQERNSYAVSVWKRVKAKLEGRDVDPNRRMSVAEQVDYVIKEATNLDNLAQLYEGWTAWV
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Quality Control Test: 12.5% SDS-PAGE Stained with Coomassie Blue.
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: SMG1 SMG1 nonsense mediated mRNA decay associated PI3K related kinase [ Homo sapiens (human) ]
• Official Symbol: SMG1
• Synonyms: SMG1; SMG1 nonsense mediated mRNA decay associated PI3K related kinase; ATX; LIP; 61E3.4; serine/threonine-protein kinase SMG1; PI-3-kinase-related kinase SMG-1; SMG1 phosphatidylinositol 3-kinase-related kinase; lambda-interacting protein; lambda/iota protein kinase C-interacting protein; nonsense mediated mRNA decay-associated PI3K-related kinase SMG1; smg-1 homolog, phosphatidylinositol 3-kinase-related kinase; EC 2.7.11.1
• Gene ID: 23049
• mRNA Refseq: NM_015092
• Protein Refseq: NP_055907
• MIM: 607032
• UniProt ID: Q96Q15