Recombinant Human SMG1 Protein, 2922-3031, N-GST tagged

Cat.No. : SMG1-13H
Product Overview : Human SMG1 partial ORF (NP_055535, 2922-3031) recombinant protein with GST-tag at N-terminal was expressed in Wheat Germ (in vitro).
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Protein Length : 2922-3031
Description : This gene encodes a protein involved in nonsense-mediated mRNA decay (NMD) as part of the mRNA surveillance complex. The protein has kinase activity and is thought to function in NMD by phosphorylating the regulator of nonsense transcripts 1 protein. Alternatively spliced transcript variants have been described, but their full-length nature has yet to be determined.
Molecular Mass : 37.84 kDa
AA Sequence : PDVMSQNARKLIQKNLATSADTPPSTVPGTGKSVACSPKKAVRDPKTGKAVQERNSYAVSVWKRVKAKLEGRDVDPNRRMSVAEQVDYVIKEATNLDNLAQLYEGWTAWV
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Quality Control Test : 12.5% SDS-PAGE Stained with Coomassie Blue.
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name SMG1 SMG1 nonsense mediated mRNA decay associated PI3K related kinase [ Homo sapiens (human) ]
Official Symbol SMG1
Synonyms SMG1; SMG1 nonsense mediated mRNA decay associated PI3K related kinase; ATX; LIP; 61E3.4; serine/threonine-protein kinase SMG1; PI-3-kinase-related kinase SMG-1; SMG1 phosphatidylinositol 3-kinase-related kinase; lambda-interacting protein; lambda/iota protein kinase C-interacting protein; nonsense mediated mRNA decay-associated PI3K-related kinase SMG1; smg-1 homolog, phosphatidylinositol 3-kinase-related kinase; EC 2.7.11.1
Gene ID 23049
mRNA Refseq NM_015092
Protein Refseq NP_055907
MIM 607032
UniProt ID Q96Q15

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All SMG1 Products

Required fields are marked with *

My Review for All SMG1 Products

Required fields are marked with *

0
cart-icon
0
compare icon