Recombinant Human SMG1 Protein, 2922-3031, N-GST tagged
| Cat.No. : | SMG1-13H |
| Product Overview : | Human SMG1 partial ORF (NP_055535, 2922-3031) recombinant protein with GST-tag at N-terminal was expressed in Wheat Germ (in vitro). |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Protein Length : | 2922-3031 |
| Description : | This gene encodes a protein involved in nonsense-mediated mRNA decay (NMD) as part of the mRNA surveillance complex. The protein has kinase activity and is thought to function in NMD by phosphorylating the regulator of nonsense transcripts 1 protein. Alternatively spliced transcript variants have been described, but their full-length nature has yet to be determined. |
| Molecular Mass : | 37.84 kDa |
| AA Sequence : | PDVMSQNARKLIQKNLATSADTPPSTVPGTGKSVACSPKKAVRDPKTGKAVQERNSYAVSVWKRVKAKLEGRDVDPNRRMSVAEQVDYVIKEATNLDNLAQLYEGWTAWV |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Quality Control Test : | 12.5% SDS-PAGE Stained with Coomassie Blue. |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | SMG1 SMG1 nonsense mediated mRNA decay associated PI3K related kinase [ Homo sapiens (human) ] |
| Official Symbol | SMG1 |
| Synonyms | SMG1; SMG1 nonsense mediated mRNA decay associated PI3K related kinase; ATX; LIP; 61E3.4; serine/threonine-protein kinase SMG1; PI-3-kinase-related kinase SMG-1; SMG1 phosphatidylinositol 3-kinase-related kinase; lambda-interacting protein; lambda/iota protein kinase C-interacting protein; nonsense mediated mRNA decay-associated PI3K-related kinase SMG1; smg-1 homolog, phosphatidylinositol 3-kinase-related kinase; EC 2.7.11.1 |
| Gene ID | 23049 |
| mRNA Refseq | NM_015092 |
| Protein Refseq | NP_055907 |
| MIM | 607032 |
| UniProt ID | Q96Q15 |
| ◆ Recombinant Proteins | ||
| SMG1-8478M | Recombinant Mouse SMG1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| SMG1-15622M | Recombinant Mouse SMG1 Protein | +Inquiry |
| SMG1-4986Z | Recombinant Zebrafish SMG1 | +Inquiry |
| SMG1-13H | Recombinant Human SMG1 Protein, 2922-3031, N-GST tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SMG1 Products
Required fields are marked with *
My Review for All SMG1 Products
Required fields are marked with *
