Recombinant Human SMNDC1 protein, GST-tagged
| Cat.No. : | SMNDC1-2817H | 
| Product Overview : | Recombinant Human SMNDC1 protein(1-238 aa), fused with N-terminal GST tag, was expressed in E.coli. | 
| Availability | October 30, 2025 | 
| Unit | |
| Price | |
| Qty | 
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human | 
| Source : | E.coli | 
| Tag : | GST | 
| Protein Length : | 1-238 aa | 
| Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 8.0). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 100 mM reduced glutathione (GSH). | 
| AASequence : | MSEDLAKQLASYKAQLQQVEAALSGNGENEDLLKLKKDLQEVIELTKDLLSTQPSETLASSDSFASTQPTHSWKVGDKCMAVWSEDGQCYEAEIEEIDEENGTAAITFAGYGNAEVTPLLNLKPVEEGRKAKEDSGNKPMSKKEMIAQQREYKKKKALKKAQRIKELEQEREDQKVKWQQFNNRAYSKNKKGQVKRSIFASPESVTGKVGVGTCGIADKPMTQYQDTSKYNVRHLMPQ | 
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. | 
| Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. | 
| Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. | 
| Gene Name | SMNDC1 survival motor neuron domain containing 1 [ Homo sapiens ] | 
| Official Symbol | SMNDC1 | 
| Synonyms | SMNDC1; survival motor neuron domain containing 1; survival of motor neuron-related-splicing factor 30; SMNR; SPF30; splicing factor 30; survival of motor neuron related; SMN-related protein; 30 kDa splicing factor SMNrp; survival motor neuron domain-containing protein 1; splicing factor 30, survival of motor neuron-related; | 
| Gene ID | 10285 | 
| mRNA Refseq | NM_005871 | 
| Protein Refseq | NP_005862 | 
| MIM | 603519 | 
| UniProt ID | O75940 | 
| ◆ Recombinant Proteins | ||
| SMNDC1-3362H | Recombinant Human SMNDC1, His-tagged | +Inquiry | 
| SMNDC1-4349R | Recombinant Rhesus monkey SMNDC1 Protein, His-tagged | +Inquiry | 
| SMNDC1-499H | Recombinant Human SMNDC1, His tagged | +Inquiry | 
| SMNDC1-5281R | Recombinant Rat SMNDC1 Protein, His (Fc)-Avi-tagged | +Inquiry | 
| SMNDC1-4165R | Recombinant Rhesus Macaque SMNDC1 Protein, His (Fc)-Avi-tagged | +Inquiry | 
| ◆ Cell & Tissue Lysates | ||
| SMNDC1-1658HCL | Recombinant Human SMNDC1 293 Cell Lysate | +Inquiry | 
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SMNDC1 Products
Required fields are marked with *
My Review for All SMNDC1 Products
Required fields are marked with *
 
  
        
    
       
                         
                             
            