Recombinant Human SMNDC1 protein, GST-tagged
| Cat.No. : | SMNDC1-2817H |
| Product Overview : | Recombinant Human SMNDC1 protein(1-238 aa), fused with N-terminal GST tag, was expressed in E.coli. |
| Availability | December 13, 2025 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | 1-238 aa |
| Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 8.0). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 100 mM reduced glutathione (GSH). |
| AASequence : | MSEDLAKQLASYKAQLQQVEAALSGNGENEDLLKLKKDLQEVIELTKDLLSTQPSETLASSDSFASTQPTHSWKVGDKCMAVWSEDGQCYEAEIEEIDEENGTAAITFAGYGNAEVTPLLNLKPVEEGRKAKEDSGNKPMSKKEMIAQQREYKKKKALKKAQRIKELEQEREDQKVKWQQFNNRAYSKNKKGQVKRSIFASPESVTGKVGVGTCGIADKPMTQYQDTSKYNVRHLMPQ |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
| Gene Name | SMNDC1 survival motor neuron domain containing 1 [ Homo sapiens ] |
| Official Symbol | SMNDC1 |
| Synonyms | SMNDC1; survival motor neuron domain containing 1; survival of motor neuron-related-splicing factor 30; SMNR; SPF30; splicing factor 30; survival of motor neuron related; SMN-related protein; 30 kDa splicing factor SMNrp; survival motor neuron domain-containing protein 1; splicing factor 30, survival of motor neuron-related; |
| Gene ID | 10285 |
| mRNA Refseq | NM_005871 |
| Protein Refseq | NP_005862 |
| MIM | 603519 |
| UniProt ID | O75940 |
| ◆ Recombinant Proteins | ||
| Smndc1-5973M | Recombinant Mouse Smndc1 Protein, Myc/DDK-tagged | +Inquiry |
| SMNDC1-2817H | Recombinant Human SMNDC1 protein, GST-tagged | +Inquiry |
| SMNDC1-4349R | Recombinant Rhesus monkey SMNDC1 Protein, His-tagged | +Inquiry |
| SMNDC1-5281R | Recombinant Rat SMNDC1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| SMNDC1-15630M | Recombinant Mouse SMNDC1 Protein | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| SMNDC1-1658HCL | Recombinant Human SMNDC1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SMNDC1 Products
Required fields are marked with *
My Review for All SMNDC1 Products
Required fields are marked with *
