Recombinant Human SMNDC1, His-tagged
| Cat.No. : | SMNDC1-31197TH |
| Product Overview : | Recombinant full length Human SMNDC1 with an N terminal His tag ; predicted mwt: 28.9 kDa. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 238 amino acids |
| Description : | This gene is a paralog of SMN1 gene, which encodes the survival motor neuron protein, mutations in which are cause of autosomal recessive proximal spinal muscular atrophy. The protein encoded by this gene is a nuclear protein that has been identified as a constituent of the spliceosome complex. This gene is differentially expressed, with abundant levels in skeletal muscle, and may share similar cellular function as the SMN1 gene. |
| Conjugation : | HIS |
| Molecular Weight : | 28.900kDa inclusive of tags |
| Form : | Liquid |
| Purity : | >90% by SDS-PAGE |
| Storage buffer : | Preservative: NoneConstituents: 10% Glycerol, 20mM Tris HCl, 100mM Sodium chloride, 1mM DTT, pH 8.0 |
| Storage : | Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles. |
| Sequences of amino acids : | MGSSHHHHHHSSGLVPRGSHMSEDLAKQLASYKAQLQQVEAALSGNGENEDLLKLKKDLQEVIELTKDLLSTQPSETLASSDSFASTQPTHSWKVGDKCMAVWSEDGQCYEAEIEEIDEENGTAAITFAGYGNAEVTPLLNLKPVEEGRKAKEDSGNKPMSKKEMIAQQREYKKKKALKKAQRIKELEQEREDQKVKWQQFNNRAYSKNKKGQVKRSIFASPESVTGKVGVGTCGIADKPMTQYQDTSKYNVRHLMPQ |
| Gene Name | SMNDC1 survival motor neuron domain containing 1 [ Homo sapiens ] |
| Official Symbol | SMNDC1 |
| Synonyms | SMNDC1; survival motor neuron domain containing 1; survival of motor neuron-related-splicing factor 30; SMNR; SPF30; splicing factor 30; survival of motor neuron related; |
| Gene ID | 10285 |
| mRNA Refseq | NM_005871 |
| Protein Refseq | NP_005862 |
| MIM | 603519 |
| Uniprot ID | O75940 |
| Chromosome Location | 10q23 |
| Pathway | Spliceosome, organism-specific biosystem; Spliceosome, conserved biosystem; |
| Function | RNA binding; protein binding; |
| ◆ Recombinant Proteins | ||
| SMNDC1-8485M | Recombinant Mouse SMNDC1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| SMNDC1-31197TH | Recombinant Human SMNDC1, His-tagged | +Inquiry |
| SMNDC1-4433H | Recombinant Human SMNDC1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| Smndc1-5973M | Recombinant Mouse Smndc1 Protein, Myc/DDK-tagged | +Inquiry |
| SMNDC1-15630M | Recombinant Mouse SMNDC1 Protein | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| SMNDC1-1658HCL | Recombinant Human SMNDC1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SMNDC1 Products
Required fields are marked with *
My Review for All SMNDC1 Products
Required fields are marked with *
