Recombinant Human SMNDC1, His-tagged

Cat.No. : SMNDC1-31197TH
Product Overview : Recombinant full length Human SMNDC1 with an N terminal His tag ; predicted mwt: 28.9 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 238 amino acids
Description : This gene is a paralog of SMN1 gene, which encodes the survival motor neuron protein, mutations in which are cause of autosomal recessive proximal spinal muscular atrophy. The protein encoded by this gene is a nuclear protein that has been identified as a constituent of the spliceosome complex. This gene is differentially expressed, with abundant levels in skeletal muscle, and may share similar cellular function as the SMN1 gene.
Conjugation : HIS
Molecular Weight : 28.900kDa inclusive of tags
Form : Liquid
Purity : >90% by SDS-PAGE
Storage buffer : Preservative: NoneConstituents: 10% Glycerol, 20mM Tris HCl, 100mM Sodium chloride, 1mM DTT, pH 8.0
Storage : Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
Sequences of amino acids : MGSSHHHHHHSSGLVPRGSHMSEDLAKQLASYKAQLQQVEAALSGNGENEDLLKLKKDLQEVIELTKDLLSTQPSETLASSDSFASTQPTHSWKVGDKCMAVWSEDGQCYEAEIEEIDEENGTAAITFAGYGNAEVTPLLNLKPVEEGRKAKEDSGNKPMSKKEMIAQQREYKKKKALKKAQRIKELEQEREDQKVKWQQFNNRAYSKNKKGQVKRSIFASPESVTGKVGVGTCGIADKPMTQYQDTSKYNVRHLMPQ
Gene Name SMNDC1 survival motor neuron domain containing 1 [ Homo sapiens ]
Official Symbol SMNDC1
Synonyms SMNDC1; survival motor neuron domain containing 1; survival of motor neuron-related-splicing factor 30; SMNR; SPF30; splicing factor 30; survival of motor neuron related;
Gene ID 10285
mRNA Refseq NM_005871
Protein Refseq NP_005862
MIM 603519
Uniprot ID O75940
Chromosome Location 10q23
Pathway Spliceosome, organism-specific biosystem; Spliceosome, conserved biosystem;
Function RNA binding; protein binding;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All SMNDC1 Products

Required fields are marked with *

My Review for All SMNDC1 Products

Required fields are marked with *

0
cart-icon
0
compare icon