Recombinant Human SMNDC1, His-tagged
Cat.No. : | SMNDC1-31197TH |
Product Overview : | Recombinant full length Human SMNDC1 with an N terminal His tag ; predicted mwt: 28.9 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 238 amino acids |
Description : | This gene is a paralog of SMN1 gene, which encodes the survival motor neuron protein, mutations in which are cause of autosomal recessive proximal spinal muscular atrophy. The protein encoded by this gene is a nuclear protein that has been identified as a constituent of the spliceosome complex. This gene is differentially expressed, with abundant levels in skeletal muscle, and may share similar cellular function as the SMN1 gene. |
Conjugation : | HIS |
Molecular Weight : | 28.900kDa inclusive of tags |
Form : | Liquid |
Purity : | >90% by SDS-PAGE |
Storage buffer : | Preservative: NoneConstituents: 10% Glycerol, 20mM Tris HCl, 100mM Sodium chloride, 1mM DTT, pH 8.0 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles. |
Sequences of amino acids : | MGSSHHHHHHSSGLVPRGSHMSEDLAKQLASYKAQLQQVEAALSGNGENEDLLKLKKDLQEVIELTKDLLSTQPSETLASSDSFASTQPTHSWKVGDKCMAVWSEDGQCYEAEIEEIDEENGTAAITFAGYGNAEVTPLLNLKPVEEGRKAKEDSGNKPMSKKEMIAQQREYKKKKALKKAQRIKELEQEREDQKVKWQQFNNRAYSKNKKGQVKRSIFASPESVTGKVGVGTCGIADKPMTQYQDTSKYNVRHLMPQ |
Gene Name | SMNDC1 survival motor neuron domain containing 1 [ Homo sapiens ] |
Official Symbol | SMNDC1 |
Synonyms | SMNDC1; survival motor neuron domain containing 1; survival of motor neuron-related-splicing factor 30; SMNR; SPF30; splicing factor 30; survival of motor neuron related; |
Gene ID | 10285 |
mRNA Refseq | NM_005871 |
Protein Refseq | NP_005862 |
MIM | 603519 |
Uniprot ID | O75940 |
Chromosome Location | 10q23 |
Pathway | Spliceosome, organism-specific biosystem; Spliceosome, conserved biosystem; |
Function | RNA binding; protein binding; |
◆ Recombinant Proteins | ||
SMNDC1-2817H | Recombinant Human SMNDC1, GST-tagged | +Inquiry |
SMNDC1-4349R | Recombinant Rhesus monkey SMNDC1 Protein, His-tagged | +Inquiry |
SMNDC1-31197TH | Recombinant Human SMNDC1, His-tagged | +Inquiry |
SMNDC1-499H | Recombinant Human SMNDC1, His tagged | +Inquiry |
SMNDC1-8485M | Recombinant Mouse SMNDC1 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SMNDC1-1658HCL | Recombinant Human SMNDC1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SMNDC1 Products
Required fields are marked with *
My Review for All SMNDC1 Products
Required fields are marked with *