Recombinant Human SMO

Cat.No. : SMO-31421TH
Product Overview : Recombinant fragment corresponding to amino acids 56-155 of Human Smoothened with proprietary tag; Predicted MWt 36.63 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 100 amino acids
Description : The protein encoded by this gene is a G protein-coupled receptor that interacts with the patched protein, a receptor for hedgehog proteins. The encoded protein tranduces signals to other proteins after activation by a hedgehog protein/patched protein complex.
Molecular Weight : 36.630kDa inclusive of tags
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.31% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : GPPPPLSHCGRAAPCEPLRYNVCLGSVLPYGATSTLLAGDSDSQEEAHGKLVLWSGLRNAPRCWAVIQPLLCAVYMPKCENDRVELPSRTLCQATRGPCA
Sequence Similarities : Belongs to the G-protein coupled receptor Fz/Smo family.Contains 1 FZ (frizzled) domain.
Gene Name SMO smoothened, frizzled family receptor [ Homo sapiens ]
Official Symbol SMO
Synonyms SMO; smoothened, frizzled family receptor; SMOH, smoothened (Drosophila) homolog , smoothened homolog (Drosophila) , smoothened, seven transmembrane spanning receptor; smoothened homolog; frizzled family member 11; FZD11;
Gene ID 6608
mRNA Refseq NM_005631
Protein Refseq NP_005622
MIM 601500
Uniprot ID Q99835
Chromosome Location 7q32.1
Pathway Basal cell carcinoma, organism-specific biosystem; Basal cell carcinoma, conserved biosystem; Class B/2 (Secretin family receptors), organism-specific biosystem; GPCR ligand binding, organism-specific biosystem; GPCRs, Other, organism-specific biosystem;
Function G-protein coupled receptor activity; PDZ domain binding; Wnt-activated receptor activity; Wnt-protein binding; drug binding;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All SMO Products

Required fields are marked with *

My Review for All SMO Products

Required fields are marked with *

0

Inquiry Basket

cartIcon