Recombinant Human SMOC1 protein, His-GST-tagged

Cat.No. : SMOC1-4564H
Product Overview : Recombinant Human SMOC1 protein(Q9H4F8)(277-382aa), fused to N-terminal His tag and GST tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : GST&His
Protein Length : 277-382aa
Form : If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Molecular Mass : 43.2 kDa
AA Sequence : GRPLPGTSTRYVMPSCESDARAKTTEADDPFKDRELPGCPEGKKMEFITSLLDALTTDMVQAINSAAPTGGGRFSEPDPSHTLEERVVHWYFSQLDSNSSNDINKR
Purity : Greater than 90% as determined by SDS-PAGE.
Storage : Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.
Gene Name SMOC1 SPARC related modular calcium binding 1 [ Homo sapiens ]
Official Symbol SMOC1
Synonyms SMOC1; SPARC related modular calcium binding 1; SPARC-related modular calcium-binding protein 1; secreted modular calcium-binding protein 1; OAS;
Gene ID 64093
mRNA Refseq NM_001034852
Protein Refseq NP_001030024
MIM 608488
UniProt ID Q9H4F8

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All SMOC1 Products

Required fields are marked with *

My Review for All SMOC1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon