Recombinant Human SMOC1 protein, His-GST-tagged
Cat.No. : | SMOC1-4564H |
Product Overview : | Recombinant Human SMOC1 protein(Q9H4F8)(277-382aa), fused to N-terminal His tag and GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST&His |
Protein Length : | 277-382aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 43.2 kDa |
AA Sequence : | GRPLPGTSTRYVMPSCESDARAKTTEADDPFKDRELPGCPEGKKMEFITSLLDALTTDMVQAINSAAPTGGGRFSEPDPSHTLEERVVHWYFSQLDSNSSNDINKR |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
Gene Name | SMOC1 SPARC related modular calcium binding 1 [ Homo sapiens ] |
Official Symbol | SMOC1 |
Synonyms | SMOC1; SPARC related modular calcium binding 1; SPARC-related modular calcium-binding protein 1; secreted modular calcium-binding protein 1; OAS; |
Gene ID | 64093 |
mRNA Refseq | NM_001034852 |
Protein Refseq | NP_001030024 |
MIM | 608488 |
UniProt ID | Q9H4F8 |
◆ Recombinant Proteins | ||
SMOC1-2085H | Recombinant Human SMOC1 Protein, His&GST-tagged | +Inquiry |
Smoc1-272M | Active Recombinant Mouse Smoc1, His-tagged | +Inquiry |
Smoc1-5974M | Recombinant Mouse Smoc1 Protein, Myc/DDK-tagged | +Inquiry |
SMOC1-243H | Recombinant Human SMOC1 protein(Met1-Val435), His-tagged | +Inquiry |
SMOC1-4564H | Recombinant Human SMOC1 protein, His-GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SMOC1-2132HCL | Recombinant Human SMOC1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SMOC1 Products
Required fields are marked with *
My Review for All SMOC1 Products
Required fields are marked with *