Recombinant Human SMPX Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | SMPX-6321H |
Product Overview : | SMPX MS Standard C13 and N15-labeled recombinant protein (NP_055147) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | This gene encodes a small protein that has no known functional domains. Mutations in this gene are a cause of X-linked deafness-4, and the encoded protein may play a role in the maintenance of inner ear cells subjected to mechanical stress. Alternatively spliced transcript variants have been observed for this gene. |
Molecular Mass : | 9.6 kDa |
AA Sequence : | MNMSKQPVSNVRAIQANINIPMGAFRPGAGQPPRRKECTPEVEEGVPPTSDEEKKPIPGAKKLPGPAVNLSEIQNIKSELKYVPKAEQTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | SMPX small muscle protein X-linked [ Homo sapiens (human) ] |
Official Symbol | SMPX |
Synonyms | SMPX; small muscle protein X-linked; Csl; DFN6; DFNX4; Chisel; small muscular protein; deafness, X-linked 6, sensorineural; stretch-responsive skeletal muscle protein |
Gene ID | 23676 |
mRNA Refseq | NM_014332 |
Protein Refseq | NP_055147 |
MIM | 300226 |
UniProt ID | Q9UHP9 |
◆ Recombinant Proteins | ||
SMPX-8498M | Recombinant Mouse SMPX Protein, His (Fc)-Avi-tagged | +Inquiry |
SMPX-5286R | Recombinant Rat SMPX Protein, His (Fc)-Avi-tagged | +Inquiry |
SMPX-6321H | Recombinant Human SMPX Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
Smpx-5978M | Recombinant Mouse Smpx Protein, Myc/DDK-tagged | +Inquiry |
SMPX-2823H | Recombinant Human SMPX, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SMPX-1653HCL | Recombinant Human SMPX 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All SMPX Products
Required fields are marked with *
My Review for All SMPX Products
Required fields are marked with *
0
Inquiry Basket