Recombinant Human SMPX Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : SMPX-6321H
Product Overview : SMPX MS Standard C13 and N15-labeled recombinant protein (NP_055147) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : This gene encodes a small protein that has no known functional domains. Mutations in this gene are a cause of X-linked deafness-4, and the encoded protein may play a role in the maintenance of inner ear cells subjected to mechanical stress. Alternatively spliced transcript variants have been observed for this gene.
Molecular Mass : 9.6 kDa
AA Sequence : MNMSKQPVSNVRAIQANINIPMGAFRPGAGQPPRRKECTPEVEEGVPPTSDEEKKPIPGAKKLPGPAVNLSEIQNIKSELKYVPKAEQTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name SMPX small muscle protein X-linked [ Homo sapiens (human) ]
Official Symbol SMPX
Synonyms SMPX; small muscle protein X-linked; Csl; DFN6; DFNX4; Chisel; small muscular protein; deafness, X-linked 6, sensorineural; stretch-responsive skeletal muscle protein
Gene ID 23676
mRNA Refseq NM_014332
Protein Refseq NP_055147
MIM 300226
UniProt ID Q9UHP9

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All SMPX Products

Required fields are marked with *

My Review for All SMPX Products

Required fields are marked with *

0

Inquiry Basket

cartIcon