Recombinant Human SMUG1 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: SMUG1-1241H
• Product Overview: SMUG1 MS Standard C13 and N15-labeled recombinant protein (NP_055126) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: This gene encodes a protein that participates in base excision repair by removing uracil from single- and double-stranded DNA. Many alternatively spliced transcript variants exist for this gene; the full-length nature is known for some but not all of the variants.
• Molecular Mass: 29.7 kDa
• AA Sequence: MPQAFLLGSIHEPAGALMEPQPCPGSLAESFLEEELRLNAELSQLQFSEPVGIIYNPVEYAWEPHRNYVTRYCQGPKEVLFLGMNPGPFGMAQTGVPFGEVSMVRDWLGIVGPVLTPPQEHPKRPVLGLECPQSEVSGARFWGFFRNLCGQPEVFFHHCFVHNLCPLLFLAPSGRNLTPAELPAKQREQLLGICDAALCRQVQLLGVRLVVGVGRLAEQRARRALAGLMPEVQVEGLLHPSPRNPQANKGWEAVAKERLNELGLLPLLLKTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: SMUG1 single-strand-selective monofunctional uracil-DNA glycosylase 1 [ Homo sapiens (human) ]
• Official Symbol: SMUG1
• Synonyms: SMUG1; single-strand-selective monofunctional uracil-DNA glycosylase 1; single-strand selective monofunctional uracil DNA glycosylase; FDG; HMUDG; UNG3; MGC104370
• Gene ID: 23583
• mRNA Refseq: NM_014311
• Protein Refseq: NP_055126
• MIM: 607753
• UniProt ID: Q53HV7