Recombinant Human SMUG1 protein, His-SUMO-tagged
Cat.No. : | SMUG1-4502H |
Product Overview : | Recombinant Human SMUG1 protein(Q53HV7)(1-177aa), fused to N-terminal His-SUMO tag, was expressed in E. coli |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 1-177aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 35.6 kDa |
AA Sequence : | MPQAFLLGSIHEPAGALMEPQPCPGSLAESFLEEELRLNAELSQLQFSEPVGIIYNPVEYAWEPHRNYVTRYCQGPKEVLFLGMNPGPFGMAQTGVPFGEVSMVRDWLGIVGPVLTPPQEHPKRPVLGLECPQSEGPRQSMGHEIKSELLMGGCSWIRGKIQCDRVQVRRPGFSSQL |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | SMUG1 single-strand-selective monofunctional uracil-DNA glycosylase 1 [ Homo sapiens ] |
Official Symbol | SMUG1 |
Synonyms | SMUG1; single-strand-selective monofunctional uracil-DNA glycosylase 1; single-strand selective monofunctional uracil DNA glycosylase; FDG; HMUDG; UNG3; MGC104370; |
Gene ID | 23583 |
mRNA Refseq | NM_001243787 |
Protein Refseq | NP_001230716 |
MIM | 607753 |
UniProt ID | Q53HV7 |
◆ Recombinant Proteins | ||
SMUG1-4502H | Recombinant Human SMUG1 protein, His-SUMO-tagged | +Inquiry |
Smug1-5983M | Recombinant Mouse Smug1 Protein, Myc/DDK-tagged | +Inquiry |
SMUG1-1241H | Recombinant Human SMUG1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
SMUG1-2826H | Recombinant Human SMUG1, GST-tagged | +Inquiry |
SMUG1-4893H | Active Recombinant Human SMUG1 protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
SMUG1-1648HCL | Recombinant Human SMUG1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All SMUG1 Products
Required fields are marked with *
My Review for All SMUG1 Products
Required fields are marked with *
0
Inquiry Basket