Recombinant Human SMUG1 protein, His-SUMO-tagged

Cat.No. : SMUG1-4502H
Product Overview : Recombinant Human SMUG1 protein(Q53HV7)(1-177aa), fused to N-terminal His-SUMO tag, was expressed in E. coli
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His&SUMO
Protein Length : 1-177aa
Form : If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Molecular Mass : 35.6 kDa
AA Sequence : MPQAFLLGSIHEPAGALMEPQPCPGSLAESFLEEELRLNAELSQLQFSEPVGIIYNPVEYAWEPHRNYVTRYCQGPKEVLFLGMNPGPFGMAQTGVPFGEVSMVRDWLGIVGPVLTPPQEHPKRPVLGLECPQSEGPRQSMGHEIKSELLMGGCSWIRGKIQCDRVQVRRPGFSSQL
Purity : Greater than 90% as determined by SDS-PAGE.
Storage : Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.
Gene Name SMUG1 single-strand-selective monofunctional uracil-DNA glycosylase 1 [ Homo sapiens ]
Official Symbol SMUG1
Synonyms SMUG1; single-strand-selective monofunctional uracil-DNA glycosylase 1; single-strand selective monofunctional uracil DNA glycosylase; FDG; HMUDG; UNG3; MGC104370;
Gene ID 23583
mRNA Refseq NM_001243787
Protein Refseq NP_001230716
MIM 607753
UniProt ID Q53HV7

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All SMUG1 Products

Required fields are marked with *

My Review for All SMUG1 Products

Required fields are marked with *

0
cart-icon
0
compare icon