Recombinant Human SNAI1 protein, His-tagged

• Cat.No.: SNAI1-7684H
• Product Overview: Recombinant Human SNAI1 protein(22-164 aa), fused with N-terminal His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 22-164 aa
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
• AA Sequence: LQDSNPEFTFQQPYDQAHLLAAIPPPEILNPTASLPMLIWDSVLAPQAQPIAWASLRLQESPRVAELTSLSDEDSGKGSQPPSPPSPAPSSFSSTSVSSLEAEAYAAFPGLGQVPKQLAQLSEAKDLQARKAFNCKYCNKEYL
• Purity: 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.

Gene Information

• Official Symbol: SNAI1
• Synonyms: SNAI1; snail homolog 1 (Drosophila); snail 1 (drosophila homolog), zinc finger protein; zinc finger protein SNAI1; SLUGH2; SNA; SNAH; SNAIL; SNAIL1; protein sna; snail 1 homolog; protein snail homolog 1; snail 1 zinc finger protein; snail 1, zinc finger protein; dJ710H13.1
• Gene ID: 6615
• mRNA Refseq: NM_005985
• Protein Refseq: NP_005976
• MIM: 604238
• UniProt ID: O95863