Recombinant Human SNAI1 protein, His-tagged
Cat.No. : | SNAI1-7684H |
Product Overview : | Recombinant Human SNAI1 protein(22-164 aa), fused with N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 22-164 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
AA Sequence : | LQDSNPEFTFQQPYDQAHLLAAIPPPEILNPTASLPMLIWDSVLAPQAQPIAWASLRLQESPRVAELTSLSDEDSGKGSQPPSPPSPAPSSFSSTSVSSLEAEAYAAFPGLGQVPKQLAQLSEAKDLQARKAFNCKYCNKEYL |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Official Symbol | SNAI1 |
Synonyms | SNAI1; snail homolog 1 (Drosophila); snail 1 (drosophila homolog), zinc finger protein; zinc finger protein SNAI1; SLUGH2; SNA; SNAH; SNAIL; SNAIL1; protein sna; snail 1 homolog; protein snail homolog 1; snail 1 zinc finger protein; snail 1, zinc finger protein; dJ710H13.1; |
Gene ID | 6615 |
mRNA Refseq | NM_005985 |
Protein Refseq | NP_005976 |
MIM | 604238 |
UniProt ID | O95863 |
◆ Recombinant Proteins | ||
SNAI1-2376HFL | Recombinant Full Length Human SNAI1, Flag-tagged | +Inquiry |
SNAI1-178H | Recombinant Human SNAI1 protein, T7/His-tagged | +Inquiry |
SNAI1-330H | Recombinant Human snail family zinc finger 1, His-tagged | +Inquiry |
SNAI1-16H | Recombinant Human SNAI1, MYC/DDK-tagged | +Inquiry |
SNAI1-15660M | Recombinant Mouse SNAI1 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
SNAI1-1643HCL | Recombinant Human SNAI1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SNAI1 Products
Required fields are marked with *
My Review for All SNAI1 Products
Required fields are marked with *