Recombinant Human SNAI1 protein, T7/His-tagged
Cat.No. : | SNAI1-178H |
Product Overview : | Recombinant human SNAL1 (264aa) protein fused with T7-His-TEV cleavage site Tag at N-terminal was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&T7 |
Form : | 0.25 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Glycerol. |
AA Sequence : | MASMTGGQQMGRGHHHHHHGNLYFQGGEFPRSFLVRKPSDPNRKPNYSELQDSNPEFTFQQPYDQAHLLAAIPPP EILNPTASLPMLIWDSVLAPQAQPIAWASLRLQESPRVAELTSLSDEDSGKGSQPPSPPSPAPSSFSSTSVSSLE AEAYAAFPGLGQVPKQLAQLSEAKDLQARKAFNCKYCNKEYLSLGALKMHIRSHTLPCVCGTCGKAFSRPWLLQG HVRTHTGEKPFSCPHCSRAFADRSNLRAHLQTHSDVKKYQCQACARTFSRMSLLHKHQESGCSGCPR |
Purity : | >90% by SDS-PAGE. |
Storage : | Keep at -80°C for long term storage. Product is stable at 4 °C for at least 30 days. |
Gene Name | SNAI1 snail homolog 1 (Drosophila) [ Homo sapiens ] |
Official Symbol | SNAI1 |
Synonyms | SNAI1; SLUGH2; SNA; SNAH; SNAIL; SNAIL1; protein sna; snail 1 homolog; protein snail homolog 1 |
Gene ID | 6615 |
mRNA Refseq | NM_005985 |
Protein Refseq | NP_005976 |
MIM | 604238 |
UniProt ID | O95863 |
Chromosome Location | 20q13.2 |
Pathway | Adherens junction, organism-specific biosystem; Adherens junction, conserved biosystem; Signaling events mediated by Hepatocyte Growth Factor Receptor (c-Met), organism-specific biosystem; Validated targets of C-MYC transcriptional activation, organism-specific biosystem; |
Function | RNA polymerase II core promoter proximal region sequence-specific DNA binding transcription factor activity involved in negative regulation of transcription; kinase binding; metal ion binding; protein binding; sequence-specific DNA binding; zinc ion binding; |
◆ Recombinant Proteins | ||
SNAI1-3405H | Recombinant Human SNAI1 Protein (Met1-Arg264), His tagged | +Inquiry |
Snai1-5989M | Recombinant Mouse Snai1 Protein, Myc/DDK-tagged | +Inquiry |
SNAI1-30016TH | Recombinant Human SNAI1 | +Inquiry |
SNAI1-15660M | Recombinant Mouse SNAI1 Protein | +Inquiry |
SNAI1-4718H | Recombinant Human SNAI1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
SNAI1-1643HCL | Recombinant Human SNAI1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SNAI1 Products
Required fields are marked with *
My Review for All SNAI1 Products
Required fields are marked with *
0
Inquiry Basket