Recombinant Human SNAI1 protein, T7/His-tagged

Cat.No. : SNAI1-178H
Product Overview : Recombinant human SNAL1 (264aa) protein fused with T7-His-TEV cleavage site Tag at N-terminal was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His&T7
Form : 0.25 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Glycerol.
AA Sequence : MASMTGGQQMGRGHHHHHHGNLYFQGGEFPRSFLVRKPSDPNRKPNYSELQDSNPEFTFQQPYDQAHLLAAIPPP EILNPTASLPMLIWDSVLAPQAQPIAWASLRLQESPRVAELTSLSDEDSGKGSQPPSPPSPAPSSFSSTSVSSLE AEAYAAFPGLGQVPKQLAQLSEAKDLQARKAFNCKYCNKEYLSLGALKMHIRSHTLPCVCGTCGKAFSRPWLLQG HVRTHTGEKPFSCPHCSRAFADRSNLRAHLQTHSDVKKYQCQACARTFSRMSLLHKHQESGCSGCPR
Purity : >90% by SDS-PAGE.
Storage : Keep at -80°C for long term storage. Product is stable at 4 °C for at least 30 days.
Gene Name SNAI1 snail homolog 1 (Drosophila) [ Homo sapiens ]
Official Symbol SNAI1
Synonyms SNAI1; SLUGH2; SNA; SNAH; SNAIL; SNAIL1; protein sna; snail 1 homolog; protein snail homolog 1
Gene ID 6615
mRNA Refseq NM_005985
Protein Refseq NP_005976
MIM 604238
UniProt ID O95863
Chromosome Location 20q13.2
Pathway Adherens junction, organism-specific biosystem; Adherens junction, conserved biosystem; Signaling events mediated by Hepatocyte Growth Factor Receptor (c-Met), organism-specific biosystem; Validated targets of C-MYC transcriptional activation, organism-specific biosystem;
Function RNA polymerase II core promoter proximal region sequence-specific DNA binding transcription factor activity involved in negative regulation of transcription; kinase binding; metal ion binding; protein binding; sequence-specific DNA binding; zinc ion binding;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All SNAI1 Products

Required fields are marked with *

My Review for All SNAI1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon