Recombinant Human SNAP47, His-tagged

Cat.No. : SNAP47-29598TH
Product Overview : Recombinant fragment, corresponding to amino acids 231-378 of Human SNAP47 with N terminal His tag; 148 amino acids, 24kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 231-378 a.a.
Description : SNAP47 belongs to the SVAP1 family. It contains two t-SNARE coiled-coil homology domains.SNAP47 has ubiquitous tissue distribution, with particularly high levels in nervous tissue. In neurons, SNAP 47 has been shown to havewidespread distribution on intracellular membranes and is enriched in synaptic vesicle fractions. In vitro, SNAP 47 can substitute for SNAP-25 in SNARE complex formation,but not as efficiently.
Conjugation : HIS
Form : Lyophilised:Reconstitute with 55 μl aqua dest.
Storage buffer : Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage : Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : FIGKPDMAYRLISAKMPEVIPILEVQFSKKMELLEDALVL RSARTSSPAEKSCSVWHAASGLMGRTLHREPPAGDQEG TALHLQTSLPALSEADTQELTQILRRMKGLALEAESEL ERQDEALDGVAAAVDRATLTIDKHNRRMKRLT
Gene Name SNAP47 synaptosomal-associated protein, 47kDa [ Homo sapiens ]
Official Symbol SNAP47
Synonyms SNAP47; synaptosomal-associated protein, 47kDa; C1orf142, chromosome 1 open reading frame 142; synaptosomal-associated protein 47; SNAP 47; SVAP1;
Gene ID 116841
mRNA Refseq NM_053052
Protein Refseq NP_444280
Uniprot ID Q5SQN1
Chromosome Location 1q42.13
Pathway SNARE interactions in vesicular transport, organism-specific biosystem; SNARE interactions in vesicular transport, conserved biosystem;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All SNAP47 Products

Required fields are marked with *

My Review for All SNAP47 Products

Required fields are marked with *

0
cart-icon