Recombinant Human SNAP47, His-tagged
Cat.No. : | SNAP47-29598TH |
Product Overview : | Recombinant fragment, corresponding to amino acids 231-378 of Human SNAP47 with N terminal His tag; 148 amino acids, 24kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 231-378 a.a. |
Description : | SNAP47 belongs to the SVAP1 family. It contains two t-SNARE coiled-coil homology domains.SNAP47 has ubiquitous tissue distribution, with particularly high levels in nervous tissue. In neurons, SNAP 47 has been shown to havewidespread distribution on intracellular membranes and is enriched in synaptic vesicle fractions. In vitro, SNAP 47 can substitute for SNAP-25 in SNARE complex formation,but not as efficiently. |
Conjugation : | HIS |
Form : | Lyophilised:Reconstitute with 55 μl aqua dest. |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | FIGKPDMAYRLISAKMPEVIPILEVQFSKKMELLEDALVL RSARTSSPAEKSCSVWHAASGLMGRTLHREPPAGDQEG TALHLQTSLPALSEADTQELTQILRRMKGLALEAESEL ERQDEALDGVAAAVDRATLTIDKHNRRMKRLT |
Gene Name | SNAP47 synaptosomal-associated protein, 47kDa [ Homo sapiens ] |
Official Symbol | SNAP47 |
Synonyms | SNAP47; synaptosomal-associated protein, 47kDa; C1orf142, chromosome 1 open reading frame 142; synaptosomal-associated protein 47; SNAP 47; SVAP1; |
Gene ID | 116841 |
mRNA Refseq | NM_053052 |
Protein Refseq | NP_444280 |
Uniprot ID | Q5SQN1 |
Chromosome Location | 1q42.13 |
Pathway | SNARE interactions in vesicular transport, organism-specific biosystem; SNARE interactions in vesicular transport, conserved biosystem; |
◆ Recombinant Proteins | ||
SNAP47-15666M | Recombinant Mouse SNAP47 Protein | +Inquiry |
SNAP47-5634R | Recombinant Rat SNAP47 Protein | +Inquiry |
SNAP47-1359H | Recombinant Human SNAP47 | +Inquiry |
SNAP47-5293R | Recombinant Rat SNAP47 Protein, His (Fc)-Avi-tagged | +Inquiry |
SNAP47-8517M | Recombinant Mouse SNAP47 Protein, His (Fc)-Avi-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SNAP47 Products
Required fields are marked with *
My Review for All SNAP47 Products
Required fields are marked with *