Recombinant Human SNAPC1 protein, His-tagged

• Cat.No.: SNAPC1-3163H
• Product Overview: Recombinant Human SNAPC1 protein(58-368 aa), fused to His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 58-368 aa
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole.
• AA Sequence: ALALAWRYFLPPYTFQIRVGALYLLYGLYNTQLCQPKQKIRVALKDWDEVLKFQQDLVNAQHFDAAYIFRKLRLDRAFHFTAMPKLLSYRMKKKIHRAEVTEEFKDPSDRVMKLITSDVLEEMLNVHDHYQNMKHVISVDKSKPDKALSLIKDDFFDNIKNIVLEHQQWHKDRKNPSLKSKTNDGEEKMEGNSQETERCERAESLAKIKSKAFSVVIQASKSRRHRQVKLDSSDSDSASGQGQVKATRKKEKKERLKPAGRKMSLRNKGNVQNIHKEDKPLSLSMPVITEEEENESLSGTEFTASKKRRKH
• Purity: 95%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
• Reconstitution: Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
  Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.

Gene Information

• Gene Name: SNAPC1 small nuclear RNA activating complex, polypeptide 1, 43kDa [ Homo sapiens ]
• Official Symbol: SNAPC1
• Synonyms: SNAPC1; small nuclear RNA activating complex, polypeptide 1, 43kDa; small nuclear RNA activating complex, polypeptide 1, 43kD; snRNA-activating protein complex subunit 1; PTFgamma; SNAP43; SNAPc subunit 1; PTF subunit gamma; SNAPc 43 kDa subunit; PSE-binding factor subunit gamma; snRNA-activating protein complex 43 kDa subunit; small nuclear RNA-activating complex polypeptide 1; proximal sequence element-binding transcription factor subunit gamma
• Gene ID: 6617
• mRNA Refseq: NM_003082
• Protein Refseq: NP_003073
• MIM: 600591
• UniProt ID: Q16533