Recombinant Human SNAPC1 protein, His-tagged
| Cat.No. : | SNAPC1-3163H |
| Product Overview : | Recombinant Human SNAPC1 protein(58-368 aa), fused to His tag, was expressed in E. coli. |
| Availability | October 03, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 58-368 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
| AA Sequence : | ALALAWRYFLPPYTFQIRVGALYLLYGLYNTQLCQPKQKIRVALKDWDEVLKFQQDLVNAQHFDAAYIFRKLRLDRAFHFTAMPKLLSYRMKKKIHRAEVTEEFKDPSDRVMKLITSDVLEEMLNVHDHYQNMKHVISVDKSKPDKALSLIKDDFFDNIKNIVLEHQQWHKDRKNPSLKSKTNDGEEKMEGNSQETERCERAESLAKIKSKAFSVVIQASKSRRHRQVKLDSSDSDSASGQGQVKATRKKEKKERLKPAGRKMSLRNKGNVQNIHKEDKPLSLSMPVITEEEENESLSGTEFTASKKRRKH |
| Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
| Gene Name | SNAPC1 small nuclear RNA activating complex, polypeptide 1, 43kDa [ Homo sapiens ] |
| Official Symbol | SNAPC1 |
| Synonyms | SNAPC1; small nuclear RNA activating complex, polypeptide 1, 43kDa; small nuclear RNA activating complex, polypeptide 1, 43kD; snRNA-activating protein complex subunit 1; PTFgamma; SNAP43; SNAPc subunit 1; PTF subunit gamma; SNAPc 43 kDa subunit; PSE-binding factor subunit gamma; snRNA-activating protein complex 43 kDa subunit; small nuclear RNA-activating complex polypeptide 1; proximal sequence element-binding transcription factor subunit gamma; |
| Gene ID | 6617 |
| mRNA Refseq | NM_003082 |
| Protein Refseq | NP_003073 |
| MIM | 600591 |
| UniProt ID | Q16533 |
| ◆ Recombinant Proteins | ||
| SNAPC1-8519M | Recombinant Mouse SNAPC1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| SNAPC1-4177R | Recombinant Rhesus Macaque SNAPC1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| SNAPC1-3163H | Recombinant Human SNAPC1 protein, His-tagged | +Inquiry |
| SNAPC1-691C | Recombinant Cynomolgus Monkey SNAPC1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| SNAPC1-4361R | Recombinant Rhesus monkey SNAPC1 Protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| SNAPC1-1638HCL | Recombinant Human SNAPC1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SNAPC1 Products
Required fields are marked with *
My Review for All SNAPC1 Products
Required fields are marked with *
