Recombinant Human SNCG protein, His-SUMO-tagged
Cat.No. : | SNCG-3510H |
Product Overview : | Recombinant Human SNCG protein(O76070)(1-127aa), fused to N-terminal His-SUMO tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 1-127aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 29.3 kDa |
AA Sequence : | MDVFKKGFSIAKEGVVGAVEKTKQGVTEAAEKTKEGVMYVGAKTKENVVQSVTSVAEKTKEQANAVSEAVVSSVNTVATKTVEEAENIAVTSGVVRKEDLRPSAPQQEGEASKEKEEVAEEAQSGGD |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | SNCG synuclein, gamma (breast cancer-specific protein 1) [ Homo sapiens ] |
Official Symbol | SNCG |
Synonyms | SNCG; synuclein, gamma (breast cancer-specific protein 1); gamma-synuclein; BCSG1; persyn; SR; synoretin; breast cancer-specific gene 1 protein; |
Gene ID | 6623 |
mRNA Refseq | NM_003087 |
Protein Refseq | NP_003078 |
MIM | 602998 |
UniProt ID | O76070 |
◆ Recombinant Proteins | ||
SNCG-247H | Recombinant Human SNCG, His-tagged | +Inquiry |
SNCG-5299R | Recombinant Rat SNCG Protein, His (Fc)-Avi-tagged | +Inquiry |
SNCG-950C | Recombinant Cynomolgus SNCG Protein, His-tagged | +Inquiry |
SNCG-3510H | Recombinant Human SNCG protein, His-SUMO-tagged | +Inquiry |
SNCG-6327H | Recombinant Human SNCG Protein (Met1-Ala122), N-GST tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SNCG-1654HCL | Recombinant Human SNCG cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SNCG Products
Required fields are marked with *
My Review for All SNCG Products
Required fields are marked with *