Recombinant Human SNCG protein, GST-tagged
| Cat.No. : | SNCG-2840H |
| Product Overview : | Recombinant Human SNCG protein(1-127 aa), fused with N-terminal GST tag, was expressed in E.coli. |
| Availability | October 30, 2025 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | 1-127 aa |
| Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 8.0). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. |
| AASequence : | MDVFKKGFSIAKEGVVGAVEKTKQGVTEAAEKTKEGVMYVGAKTKENVVQSVTSVAEKTKEQANAVSEAVVSSVNTVATKTVEEAENIAVTSGVVRKEDLRPSAPQQEGEASKEKEEVAEEAQSGGD |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
| Gene Name | SNCG synuclein, gamma (breast cancer-specific protein 1) [ Homo sapiens ] |
| Official Symbol | SNCG |
| Synonyms | SNCG; synuclein, gamma (breast cancer-specific protein 1); gamma-synuclein; BCSG1; persyn; SR; synoretin; breast cancer-specific gene 1 protein; |
| Gene ID | 6623 |
| mRNA Refseq | NM_003087 |
| Protein Refseq | NP_003078 |
| MIM | 602998 |
| UniProt ID | O76070 |
| ◆ Recombinant Proteins | ||
| SNCG-6326H | Recombinant Human SNCG Protein (Met1-Asp127) | +Inquiry |
| SNCG-2488H | Recombinant Human SNCG protein(11-120 aa), C-His-tagged | +Inquiry |
| SNCG-6238C | Recombinant Chicken SNCG | +Inquiry |
| SNCG-2456C | Recombinant Cynomolgus Monkey SNCG Protein (1-127 aa) | +Inquiry |
| Sncg-5645M | Recombinant Mouse Sncg protein, His & T7-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| SNCG-1654HCL | Recombinant Human SNCG cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SNCG Products
Required fields are marked with *
My Review for All SNCG Products
Required fields are marked with *
