Recombinant Human SNCG protein, GST-tagged
Cat.No. : | SNCG-2840H |
Product Overview : | Recombinant Human SNCG protein(1-127 aa), fused with N-terminal GST tag, was expressed in E.coli. |
Availability | August 22, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 1-127 aa |
Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 8.0). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. |
AASequence : | MDVFKKGFSIAKEGVVGAVEKTKQGVTEAAEKTKEGVMYVGAKTKENVVQSVTSVAEKTKEQANAVSEAVVSSVNTVATKTVEEAENIAVTSGVVRKEDLRPSAPQQEGEASKEKEEVAEEAQSGGD |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
Gene Name | SNCG synuclein, gamma (breast cancer-specific protein 1) [ Homo sapiens ] |
Official Symbol | SNCG |
Synonyms | SNCG; synuclein, gamma (breast cancer-specific protein 1); gamma-synuclein; BCSG1; persyn; SR; synoretin; breast cancer-specific gene 1 protein; |
Gene ID | 6623 |
mRNA Refseq | NM_003087 |
Protein Refseq | NP_003078 |
MIM | 602998 |
UniProt ID | O76070 |
◆ Recombinant Proteins | ||
SNCG-2840H | Recombinant Human SNCG protein, GST-tagged | +Inquiry |
SNCG-134H | Recombinant Human SNCG | +Inquiry |
SNCG-4367R | Recombinant Rhesus monkey SNCG Protein, His-tagged | +Inquiry |
SNCG-6327H | Recombinant Human SNCG Protein (Met1-Ala122), N-GST tagged | +Inquiry |
SNCG-693C | Recombinant Cynomolgus Monkey SNCG Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SNCG-1654HCL | Recombinant Human SNCG cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SNCG Products
Required fields are marked with *
My Review for All SNCG Products
Required fields are marked with *