Recombinant Human SNPH protein, His-SUMO-tagged
Cat.No. : | SNPH-3511H |
Product Overview : | Recombinant Human SNPH protein(O15079)(1-424aa), fused to N-terminal His-SUMO tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 1-424aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 62 kDa |
AA Sequence : | MAMSLPGSRRTSAGSRRRTSPPVSVRDAYGTSSLSSSSNSGSYKGSDSSPTPRRSMKYTLCSDNHGIKPPTPEQYLTPLQQKEVCIRHLKARLKDTQDRLQDRDTEIDDLKTQLSRMQEDWIEEECHRVEAQLALKEARKEIKQLKQVIDTVKNNLIDKDKGLQKYFVDINIQNKKLETLLHSMEVAQNGMAKEDGTGESAGGSPARSLTRSSTYTKLSDPAVCGDRQPGDPSSGSAEDGADSGFAAADDTLSRTDALEASSLLSSGVDCGTEETSLHSSFGLGPRFPASNTYEKLLCGMEAGVQASCMQERAIQTDFVQYQPDLDTILEKVTQAQVCGTDPESGDRCPELDAHPSGPRDPNSAVVVTVGDELEAPEPITRGPTPQRPGANPNPGQSVSVVCPMEEEEEAAVAEKEPKSYWSRH |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | SNPH syntaphilin [ Homo sapiens ] |
Official Symbol | SNPH |
Synonyms | SNPH; syntaphilin; bA314N13.5; KIAA0374; MGC46096; |
Gene ID | 9751 |
mRNA Refseq | NM_014723 |
Protein Refseq | NP_055538 |
MIM | 604942 |
UniProt ID | O15079 |
◆ Recombinant Proteins | ||
RFL5471MF | Recombinant Full Length Mouse Syntaphilin(Snph) Protein, His-Tagged | +Inquiry |
RFL17352HF | Recombinant Full Length Human Syntaphilin(Snph) Protein, His-Tagged | +Inquiry |
SNPH-2845H | Recombinant Human SNPH, GST-tagged | +Inquiry |
SNPH-5304R | Recombinant Rat SNPH Protein, His (Fc)-Avi-tagged | +Inquiry |
SNPH-27725TH | Recombinant Human SNPH, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SNPH-1627HCL | Recombinant Human SNPH 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All SNPH Products
Required fields are marked with *
My Review for All SNPH Products
Required fields are marked with *
0
Inquiry Basket