Recombinant Human SNRPB2 protein, GST-tagged
Cat.No. : | SNRPB2-3733H |
Product Overview : | Recombinant Human SNRPB2 protein(1-225 aa), fused to GST tag, was expressed in E. coli. |
Availability | July 05, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 1-225 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 100mM GSH. |
AA Sequence : | MDIRPNHTIYINNMNDKIKKEELKRSLYALFSQFGHVVDIVALKTMKMRGQAFVIFKELGSSTNALRQLQGFPFYGKPMRIQYAKTDSDIISKMRGTFADKEKKKEKKKAKTVEQTATTTNKKPGQGTPNSANTQGNSTPNPQVPDYPPNYILFLNNLPEETNEMMLSMLFNQFPGFKEVRLVPGRHDIAFVEFENDGQAGAARDALQGFKITPSHAMKITYAKK |
Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | SNRPB2 small nuclear ribonucleoprotein polypeptide B [ Homo sapiens ] |
Official Symbol | SNRPB2 |
Synonyms | SNRPB2; small nuclear ribonucleoprotein polypeptide B; small nuclear ribonucleoprotein polypeptide B , small nuclear ribonucleoprotein polypeptide B2; U2 small nuclear ribonucleoprotein B; Msl1; U2 snRNP B; small nuclear ribonucleoprotein polypeptide B2; MGC24807; MGC45309; |
Gene ID | 6629 |
mRNA Refseq | NM_003092 |
Protein Refseq | NP_003083 |
MIM | 603520 |
UniProt ID | P08579 |
◆ Recombinant Proteins | ||
SNRPB2-3522H | Recombinant Human SNRPB2, His-tagged | +Inquiry |
SNRPB2-3733H | Recombinant Human SNRPB2 protein, GST-tagged | +Inquiry |
SNRPB2-8121Z | Recombinant Zebrafish SNRPB2 | +Inquiry |
SNRPB2-4194R | Recombinant Rhesus Macaque SNRPB2 Protein, His (Fc)-Avi-tagged | +Inquiry |
SNRPB2-4378R | Recombinant Rhesus monkey SNRPB2 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SNRPB2-1615HCL | Recombinant Human SNRPB2 293 Cell Lysate | +Inquiry |
SNRPB2-1616HCL | Recombinant Human SNRPB2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SNRPB2 Products
Required fields are marked with *
My Review for All SNRPB2 Products
Required fields are marked with *