Recombinant Human SNRPB2 Protein (1-225 aa), His-SUMO-tagged
| Cat.No. : | SNRPB2-959H |
| Product Overview : | Recombinant Human SNRPB2 Protein (1-225 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-SUMO tag at the N-terminal. Protein Description: Full Length. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His&SUMO |
| Protein Length : | 1-225 aa |
| Description : | Involved in pre-mRNA splicing. This protein is associated with snRNP U2. It binds st loop IV of U2 snRNA only in presence of the U2A' protein. |
| Form : | Tris-based buffer, 50% glycerol |
| Molecular Mass : | 41.5 kDa |
| AA Sequence : | MDIRPNHTIYINNMNDKIKKEELKRSLYALFSQFGHVVDIVALKTMKMRGQAFVIFKELGSSTNALRQLQGFPFYGKPMRIQYAKTDSDIISKMRGTFADKEKKKEKKKAKTVEQTATTTNKKPGQGTPNSANTQGNSTPNPQVPDYPPNYILFLNNLPEETNEMMLSMLFNQFPGFKEVRLVPGRHDIAFVEFENDGQAGAARDALQGFKITPSHAMKITYAKK |
| Purity : | > 90% as determined by SDS-PAGE. |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
| Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
| Concentration : | A hardcopy of COA with concentration instruction is sent along with the products. |
| Gene Name | SNRPB2 small nuclear ribonucleoprotein polypeptide B [ Homo sapiens ] |
| Official Symbol | SNRPB2 |
| Synonyms | SNRPB2; Msl1; U2 snRNP B; MGC24807; MGC45309; |
| Gene ID | 6629 |
| mRNA Refseq | NM_003092 |
| Protein Refseq | NP_003083 |
| MIM | 603520 |
| UniProt ID | P08579 |
| ◆ Recombinant Proteins | ||
| SNRPB2-4378R | Recombinant Rhesus monkey SNRPB2 Protein, His-tagged | +Inquiry |
| SNRPB2-3733H | Recombinant Human SNRPB2 protein, GST-tagged | +Inquiry |
| SNRPB2-8121Z | Recombinant Zebrafish SNRPB2 | +Inquiry |
| SNRPB2-4194R | Recombinant Rhesus Macaque SNRPB2 Protein, His (Fc)-Avi-tagged | +Inquiry |
| SNRPB2-959H | Recombinant Human SNRPB2 Protein (1-225 aa), His-SUMO-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| SNRPB2-1616HCL | Recombinant Human SNRPB2 293 Cell Lysate | +Inquiry |
| SNRPB2-1615HCL | Recombinant Human SNRPB2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SNRPB2 Products
Required fields are marked with *
My Review for All SNRPB2 Products
Required fields are marked with *
