Recombinant Human SNRPB2 Protein (1-225 aa), His-SUMO-tagged

• Cat.No.: SNRPB2-959H
• Product Overview: Recombinant Human SNRPB2 Protein (1-225 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-SUMO tag at the N-terminal. Protein Description: Full Length.

Specification

• Species: Human
• Source: E.coli
• Tag: His&SUMO
• Protein Length: 1-225 aa
• Description: Involved in pre-mRNA splicing. This protein is associated with snRNP U2. It binds st loop IV of U2 snRNA only in presence of the U2A' protein.
• Form: Tris-based buffer, 50% glycerol
• Molecular Mass: 41.5 kDa
• AA Sequence: MDIRPNHTIYINNMNDKIKKEELKRSLYALFSQFGHVVDIVALKTMKMRGQAFVIFKELGSSTNALRQLQGFPFYGKPMRIQYAKTDSDIISKMRGTFADKEKKKEKKKAKTVEQTATTTNKKPGQGTPNSANTQGNSTPNPQVPDYPPNYILFLNNLPEETNEMMLSMLFNQFPGFKEVRLVPGRHDIAFVEFENDGQAGAARDALQGFKITPSHAMKITYAKK
• Purity: > 90% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA with concentration instruction is sent along with the products.

Gene Information

• Gene Name: SNRPB2 small nuclear ribonucleoprotein polypeptide B [ Homo sapiens ]
• Official Symbol: SNRPB2
• Synonyms: SNRPB2; Msl1; U2 snRNP B; MGC24807; MGC45309
• Gene ID: 6629
• mRNA Refseq: NM_003092
• Protein Refseq: NP_003083
• MIM: 603520
• UniProt ID: P08579