Recombinant Human SNRPC Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | SNRPC-2822H |
Product Overview : | SNRPC MS Standard C13 and N15-labeled recombinant protein (NP_003084) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | This gene encodes one of the specific protein components of the U1 small nuclear ribonucleoprotein (snRNP) particle required for the formation of the spliceosome. The encoded protein participates in the processing of nuclear precursor messenger RNA splicing. snRNP particles are attacked by autoantibodies frequently produced by patients with connective tissue diseases. The genome contains several pseudogenes of this functional gene. Alternative splicing results in a non-coding transcript variant. |
Molecular Mass : | 17.2 kDa |
AA Sequence : | MPKFYCDYCDTYLTHDSPSVRKTHCSGRKHKENVKDYYQKWMEEQAQSLIDKTTAAFQQGKIPPTPFSAPPPAGAMIPPPPSLPGPPRPGMMPAPHMGGPPMMPMMGPPPPGMMPVGPAPGMRPPMGGHMPMMPGPPMMRPPARPMMVPTRPGMTRPDRTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | SNRPC small nuclear ribonucleoprotein polypeptide C [ Homo sapiens (human) ] |
Official Symbol | SNRPC |
Synonyms | SNRPC; small nuclear ribonucleoprotein polypeptide C; U1 small nuclear ribonucleoprotein C; U1 C; Yhc1; U1 snRNP C; U1 snRNP protein C; U1 small nuclear RNP specific C; U1C; FLJ20302; |
Gene ID | 6631 |
mRNA Refseq | NM_003093 |
Protein Refseq | NP_003084 |
MIM | 603522 |
UniProt ID | P09234 |
◆ Recombinant Proteins | ||
SNRPC-30605TH | Recombinant Human SNRPC, His-tagged | +Inquiry |
SNRPC-5648R | Recombinant Rat SNRPC Protein | +Inquiry |
Snrpc-6006M | Recombinant Mouse Snrpc Protein, Myc/DDK-tagged | +Inquiry |
SNRPC-6328H | Recombinant Human SNRPC Protein | +Inquiry |
SNRPC-2822H | Recombinant Human SNRPC Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
SNRPC-616HCL | Recombinant Human SNRPC lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SNRPC Products
Required fields are marked with *
My Review for All SNRPC Products
Required fields are marked with *