Recombinant Human SNRPD3 protein(11-100 aa), N-MBP & C-His-tagged
Cat.No. : | SNRPD3-2804H |
Product Overview : | Recombinant Human SNRPD3 protein(P62318)(11-100 aa), fused with N-terminal MBP tag and C-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&MBP |
Protein Length : | 11-100 aa |
Form : | 0.15 M Phosphate buffered saline |
Storage : | Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing. Up to 12 months when aliquoted and stored at -20 to -80°C. |
Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
AA Sequence : | HEAEGHIVTCETNTGEVYRGKLIEAEDNMNCQMSNITVTYRDGRVAQLEQVYIRGSKIRFLILPDMLKNAPMLKSMKNKNQGSGAGRGKA |
Gene Name | SNRPD3 small nuclear ribonucleoprotein D3 polypeptide 18kDa [ Homo sapiens ] |
Official Symbol | SNRPD3 |
Synonyms | SMD3; Sm-D3 |
Gene ID | 6634 |
mRNA Refseq | NM_004175.3 |
Protein Refseq | NP_004166.1 |
MIM | 601062 |
UniProt ID | P62318 |
◆ Recombinant Proteins | ||
SNRPD3-4381R | Recombinant Rhesus monkey SNRPD3 Protein, His-tagged | +Inquiry |
SNRPD3-4197R | Recombinant Rhesus Macaque SNRPD3 Protein, His (Fc)-Avi-tagged | +Inquiry |
SNRPD3-8538M | Recombinant Mouse SNRPD3 Protein, His (Fc)-Avi-tagged | +Inquiry |
SNRPD3-313Z | Recombinant Zebrafish SNRPD3 | +Inquiry |
SNRPD3-2803H | Recombinant Human SNRPD3 protein(51-120 aa), N-MBP & C-His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SNRPD3 Products
Required fields are marked with *
My Review for All SNRPD3 Products
Required fields are marked with *