Recombinant Human SNRPE Protein, Myc/DDK-tagged, C13 and N15-labeled
| Cat.No. : | SNRPE-3687H |
| Product Overview : | SNRPE MS Standard C13 and N15-labeled recombinant protein (NP_003085) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | DDK&Myc |
| Description : | The protein encoded by this gene is a core component of U small nuclear ribonucleoproteins, which are key components of the pre-mRNA processing spliceosome. The encoded protein plays a role in the 3' end processing of histone transcripts. This protein is one of the targets in the autoimmune disease systemic lupus erythematosus, and mutations in this gene have been associated with hypotrichosis. Several pseudogenes of this gene have been identified. |
| Molecular Mass : | 10.6 kDa |
| AA Sequence : | MAYRGQGQKVQKVMVQPINLIFRYLQNRSRIQVWLYEQVNMRIEGCIIGFDEYMNLVLDDAEEIHSKTKSRKQLGRIMLKGDNITLLQSVSNTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
| Concentration : | 50 μg/mL as determined by BCA |
| Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
| Gene Name | SNRPE small nuclear ribonucleoprotein polypeptide E [ Homo sapiens (human) ] |
| Official Symbol | SNRPE |
| Synonyms | SNRPE; small nuclear ribonucleoprotein polypeptide E; small nuclear ribonucleoprotein E; Sm E; snRNP-E; sm protein E; SME; Sm-E; B-raf; |
| Gene ID | 6635 |
| mRNA Refseq | NM_003094 |
| Protein Refseq | NP_003085 |
| MIM | 128260 |
| UniProt ID | P62304 |
| ◆ Recombinant Proteins | ||
| SNRPE-8539M | Recombinant Mouse SNRPE Protein, His (Fc)-Avi-tagged | +Inquiry |
| SNRPE-6802C | Recombinant Chicken SNRPE | +Inquiry |
| SNRPE-2714H | Recombinant Human SNRPE Protein, His-tagged | +Inquiry |
| Snrpe-6007M | Recombinant Mouse Snrpe Protein, Myc/DDK-tagged | +Inquiry |
| SNRPE-4198R | Recombinant Rhesus Macaque SNRPE Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| SNRPE-1613HCL | Recombinant Human SNRPE 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SNRPE Products
Required fields are marked with *
My Review for All SNRPE Products
Required fields are marked with *
