Recombinant Human SNRPE Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : SNRPE-3687H
Product Overview : SNRPE MS Standard C13 and N15-labeled recombinant protein (NP_003085) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : The protein encoded by this gene is a core component of U small nuclear ribonucleoproteins, which are key components of the pre-mRNA processing spliceosome. The encoded protein plays a role in the 3' end processing of histone transcripts. This protein is one of the targets in the autoimmune disease systemic lupus erythematosus, and mutations in this gene have been associated with hypotrichosis. Several pseudogenes of this gene have been identified.
Molecular Mass : 10.6 kDa
AA Sequence : MAYRGQGQKVQKVMVQPINLIFRYLQNRSRIQVWLYEQVNMRIEGCIIGFDEYMNLVLDDAEEIHSKTKSRKQLGRIMLKGDNITLLQSVSNTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name SNRPE small nuclear ribonucleoprotein polypeptide E [ Homo sapiens (human) ]
Official Symbol SNRPE
Synonyms SNRPE; small nuclear ribonucleoprotein polypeptide E; small nuclear ribonucleoprotein E; Sm E; snRNP-E; sm protein E; SME; Sm-E; B-raf;
Gene ID 6635
mRNA Refseq NM_003094
Protein Refseq NP_003085
MIM 128260
UniProt ID P62304

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All SNRPE Products

Required fields are marked with *

My Review for All SNRPE Products

Required fields are marked with *

0

Inquiry Basket

cartIcon