Recombinant Human SNRPG protein, GST-tagged
Cat.No. : | SNRPG-2852H |
Product Overview : | Recombinant Human SNRPG protein(1-76 aa), fused with N-terminal GST tag, was expressed in E.coli. |
Availability | August 08, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 1-76 aa |
Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 8.0). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. |
AASequence : | MSKAHPPELKKFMDKKLSLKLNGGRHVQGILRGFDPFMNLVIDECVEMATSGQQNNIGMVVIRGNSIIMLEALERV |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
Gene Name | SNRPG small nuclear ribonucleoprotein polypeptide G [ Homo sapiens ] |
Official Symbol | SNRPG |
Synonyms | SNRPG; small nuclear ribonucleoprotein polypeptide G; small nuclear ribonucleoprotein G; Sm G; snRNP-G; sm protein G; SMG; Sm-G; MGC117317; |
Gene ID | 6637 |
mRNA Refseq | NM_003096 |
Protein Refseq | NP_003087 |
MIM | 603542 |
UniProt ID | P62308 |
◆ Recombinant Proteins | ||
Snrpg-6009M | Recombinant Mouse Snrpg Protein, Myc/DDK-tagged | +Inquiry |
SNRPG-3507H | Recombinant Human SNRPG, His-tagged | +Inquiry |
SNRPG-8541M | Recombinant Mouse SNRPG Protein, His (Fc)-Avi-tagged | +Inquiry |
SNRPG-2716H | Recombinant Human SNRPG Protein, His-tagged | +Inquiry |
SNRPG-2852H | Recombinant Human SNRPG protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SNRPG-1611HCL | Recombinant Human SNRPG 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SNRPG Products
Required fields are marked with *
My Review for All SNRPG Products
Required fields are marked with *