Recombinant Human SNRPG Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | SNRPG-2019H |
Product Overview : | SNRPG MS Standard C13 and N15-labeled recombinant protein (NP_003087) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | The protein encoded by this gene is a component of the U1, U2, U4, and U5 small nuclear ribonucleoprotein complexes, precursors of the spliceosome. The encoded protein may also be a part of the U7 small nuclear ribonucleoprotein complex, which participates in the processing of the 3' end of histone transcripts. Several transcript variants encoding different isoforms have been found for this gene. |
Molecular Mass : | 8.5 kDa |
AA Sequence : | MSKAHPPELKKFMDKKLSLKLNGGRHVQGILRGFDPFMNLVIDECVEMATSGQQNNIGMVVIRGNSIIMLEALERVTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | SNRPG small nuclear ribonucleoprotein polypeptide G [ Homo sapiens (human) ] |
Official Symbol | SNRPG |
Synonyms | SNRPG; small nuclear ribonucleoprotein polypeptide G; small nuclear ribonucleoprotein G; Sm G; snRNP-G; sm protein G; SMG; Sm-G; MGC117317; |
Gene ID | 6637 |
mRNA Refseq | NM_003096 |
Protein Refseq | NP_003087 |
MIM | 603542 |
UniProt ID | P62308 |
◆ Recombinant Proteins | ||
SNRPG-2716H | Recombinant Human SNRPG Protein, His-tagged | +Inquiry |
SNRPG-4383R | Recombinant Rhesus monkey SNRPG Protein, His-tagged | +Inquiry |
SNRPG-1372Z | Recombinant Zebrafish SNRPG | +Inquiry |
SNRPG-3507H | Recombinant Human SNRPG, His-tagged | +Inquiry |
SNRPG-7631Z | Recombinant Zebrafish SNRPG | +Inquiry |
◆ Cell & Tissue Lysates | ||
SNRPG-1611HCL | Recombinant Human SNRPG 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SNRPG Products
Required fields are marked with *
My Review for All SNRPG Products
Required fields are marked with *