Recombinant Human SNRPG Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : SNRPG-2019H
Product Overview : SNRPG MS Standard C13 and N15-labeled recombinant protein (NP_003087) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : The protein encoded by this gene is a component of the U1, U2, U4, and U5 small nuclear ribonucleoprotein complexes, precursors of the spliceosome. The encoded protein may also be a part of the U7 small nuclear ribonucleoprotein complex, which participates in the processing of the 3' end of histone transcripts. Several transcript variants encoding different isoforms have been found for this gene.
Molecular Mass : 8.5 kDa
AA Sequence : MSKAHPPELKKFMDKKLSLKLNGGRHVQGILRGFDPFMNLVIDECVEMATSGQQNNIGMVVIRGNSIIMLEALERVTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name SNRPG small nuclear ribonucleoprotein polypeptide G [ Homo sapiens (human) ]
Official Symbol SNRPG
Synonyms SNRPG; small nuclear ribonucleoprotein polypeptide G; small nuclear ribonucleoprotein G; Sm G; snRNP-G; sm protein G; SMG; Sm-G; MGC117317;
Gene ID 6637
mRNA Refseq NM_003096
Protein Refseq NP_003087
MIM 603542
UniProt ID P62308

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All SNRPG Products

Required fields are marked with *

My Review for All SNRPG Products

Required fields are marked with *

0

Inquiry Basket

cartIcon