Recombinant Human SNX16 protein, His-tagged
| Cat.No. : | SNX16-4533H |
| Product Overview : | Recombinant Human SNX16 protein(P57768)(1-344aa), fused with N-terminal His tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 1-344aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 43.2 kDa |
| Purity : | Greater than 85% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
| AA Sequence : | MATPYVPVPMPIGNSASSFTTNRNQRSSSFGSVSTSSNSSKGQLEDSNMGNFKQTSVPDQMDNTSSVCSSPLIRTKFTGTASSIEYSTRPRDTEEQNPETVNWEDRPSTPTILGYEVMEERAKFTVYKILVKKTPEESWVVFRRYTDFSRLNDKLKEMFPGFRLALPPKRWFKDNYNADFLEDRQLGLQAFLQNLVAHKDIANCLAVREFLCLDDPPGPFDSLEESRAFCETLEETNYRLQKELLEKQKEMESLKKLLSEKQLHIDTLENRIRTLSLEPEESLDVSETEGEQILKVESSALEVDQDVLDEESRADNKPCLSFSEPENAVSEIEVAEVAYDAEED |
| Gene Name | SNX16 sorting nexin 16 [ Homo sapiens ] |
| Official Symbol | SNX16 |
| Synonyms | SNX16; sorting nexin 16; sorting nexin-16; DKFZp666H147; |
| Gene ID | 64089 |
| mRNA Refseq | NM_022133 |
| Protein Refseq | NP_071416 |
| UniProt ID | P57768 |
| ◆ Recombinant Proteins | ||
| SNX16-11691Z | Recombinant Zebrafish SNX16 | +Inquiry |
| SNX16-4533H | Recombinant Human SNX16 protein, His-tagged | +Inquiry |
| SNX16-4339C | Recombinant Chicken SNX16 | +Inquiry |
| SNX16-3178H | Recombinant Human SNX16 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| SNX16-5313R | Recombinant Rat SNX16 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| SNX16-1597HCL | Recombinant Human SNX16 293 Cell Lysate | +Inquiry |
| SNX16-1599HCL | Recombinant Human SNX16 293 Cell Lysate | +Inquiry |
| SNX16-1598HCL | Recombinant Human SNX16 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SNX16 Products
Required fields are marked with *
My Review for All SNX16 Products
Required fields are marked with *
