Recombinant Human SNX31 Protein, GST-tagged

Cat.No. : SNX31-5278H
Product Overview : Human MGC39715 partial ORF ( AAH31260, 242 a.a. - 341 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : SNX31 (Sorting Nexin 31) is a Protein Coding gene. GO annotations related to this gene include phosphatidylinositol binding. An important paralog of this gene is SNX17.
Molecular Mass : 36.74 kDa
AA Sequence : QNLELRFQYSEDSCWQWFVIYTKQAFLLSSCLKKMISEKMVKLAAENTEMQIEVPEQSKSKKYHIQQSQQKDYSSFLSRKSKIKIAKGDCVFGNIKEEDL
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name SNX31 sorting nexin 31 [ Homo sapiens ]
Official Symbol SNX31
Synonyms SNX31; sorting nexin 31; sorting nexin-31; MGC39715;
Gene ID 169166
mRNA Refseq NM_152628
Protein Refseq NP_689841
UniProt ID Q8N9S9

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All SNX31 Products

Required fields are marked with *

My Review for All SNX31 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon