Recombinant Human SNX31 Protein, GST-tagged
Cat.No. : | SNX31-5278H |
Product Overview : | Human MGC39715 partial ORF ( AAH31260, 242 a.a. - 341 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | SNX31 (Sorting Nexin 31) is a Protein Coding gene. GO annotations related to this gene include phosphatidylinositol binding. An important paralog of this gene is SNX17. |
Molecular Mass : | 36.74 kDa |
AA Sequence : | QNLELRFQYSEDSCWQWFVIYTKQAFLLSSCLKKMISEKMVKLAAENTEMQIEVPEQSKSKKYHIQQSQQKDYSSFLSRKSKIKIAKGDCVFGNIKEEDL |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | SNX31 sorting nexin 31 [ Homo sapiens ] |
Official Symbol | SNX31 |
Synonyms | SNX31; sorting nexin 31; sorting nexin-31; MGC39715; |
Gene ID | 169166 |
mRNA Refseq | NM_152628 |
Protein Refseq | NP_689841 |
UniProt ID | Q8N9S9 |
◆ Recombinant Proteins | ||
SNX31-15732M | Recombinant Mouse SNX31 Protein | +Inquiry |
SNX31-4469H | Recombinant Human SNX31 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
SNX31-5278H | Recombinant Human SNX31 Protein, GST-tagged | +Inquiry |
Snx31-6032M | Recombinant Mouse Snx31 Protein, Myc/DDK-tagged | +Inquiry |
SNX31-8556M | Recombinant Mouse SNX31 Protein, His (Fc)-Avi-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SNX31 Products
Required fields are marked with *
My Review for All SNX31 Products
Required fields are marked with *