Recombinant Human SNX32 Protein, GST-tagged

Cat.No. : SNX32-4300H
Product Overview : Human FLJ30934 full-length ORF ( NP_689973.2, 1 a.a. - 403 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : SNX32 (Sorting Nexin 32) is a Protein Coding gene. Among its related pathways are Endocytosis. GO annotations related to this gene include phosphatidylinositol binding. An important paralog of this gene is SNX6.
Molecular Mass : 72.8 kDa
AA Sequence : METYAEVGKEGKPSCASVDLQGDSSLQVEISDAVSERDKVKFTVQTKSCLPHFAQTEFSVVRQHEEFIWLHDAYVENEEYAGLIIPPAPPRPDFEASREKLQKLGEGDSSVTREEFAKMKQELEAEYLAIFKKTVAMHEVFLQRLAAHPTLRRDHNFFVFLEYGQDLSVRGKNRKELLGGFLRNIVKSADEALITGMSGLKEVDDFFEHERTFLLEYHTRIRDACLRADRVMRAHKCLADDYIPISAALSSLGTQEVNQLRTSFLKLAELFERLRKLEGRVASDEDLKLSDMLRYYMRDSQAAKDLLYRRLRALADYENANKALDKARTRNREVRPAESHQQLCCQRFERLSDSAKQELMDFKSRRVSSFRKNLIELAELELKHAKASTLILRNTLVALKGEP
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name SNX32 sorting nexin 32 [ Homo sapiens ]
Official Symbol SNX32
Synonyms SNX32; sorting nexin 32; SNX6B, sorting nexin 6B; sorting nexin-32; FLJ30934; sorting nexin 6B; sorting nexin-6B; SNX6B; MGC42112; MGC57276; DKFZp761P1320;
Gene ID 254122
mRNA Refseq NM_152760
Protein Refseq NP_689973
UniProt ID Q86XE0

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All SNX32 Products

Required fields are marked with *

My Review for All SNX32 Products

Required fields are marked with *

0
cart-icon