Recombinant Human SNX32 Protein, GST-tagged
Cat.No. : | SNX32-4300H |
Product Overview : | Human FLJ30934 full-length ORF ( NP_689973.2, 1 a.a. - 403 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | SNX32 (Sorting Nexin 32) is a Protein Coding gene. Among its related pathways are Endocytosis. GO annotations related to this gene include phosphatidylinositol binding. An important paralog of this gene is SNX6. |
Molecular Mass : | 72.8 kDa |
AA Sequence : | METYAEVGKEGKPSCASVDLQGDSSLQVEISDAVSERDKVKFTVQTKSCLPHFAQTEFSVVRQHEEFIWLHDAYVENEEYAGLIIPPAPPRPDFEASREKLQKLGEGDSSVTREEFAKMKQELEAEYLAIFKKTVAMHEVFLQRLAAHPTLRRDHNFFVFLEYGQDLSVRGKNRKELLGGFLRNIVKSADEALITGMSGLKEVDDFFEHERTFLLEYHTRIRDACLRADRVMRAHKCLADDYIPISAALSSLGTQEVNQLRTSFLKLAELFERLRKLEGRVASDEDLKLSDMLRYYMRDSQAAKDLLYRRLRALADYENANKALDKARTRNREVRPAESHQQLCCQRFERLSDSAKQELMDFKSRRVSSFRKNLIELAELELKHAKASTLILRNTLVALKGEP |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | SNX32 sorting nexin 32 [ Homo sapiens ] |
Official Symbol | SNX32 |
Synonyms | SNX32; sorting nexin 32; SNX6B, sorting nexin 6B; sorting nexin-32; FLJ30934; sorting nexin 6B; sorting nexin-6B; SNX6B; MGC42112; MGC57276; DKFZp761P1320; |
Gene ID | 254122 |
mRNA Refseq | NM_152760 |
Protein Refseq | NP_689973 |
UniProt ID | Q86XE0 |
◆ Recombinant Proteins | ||
Snx32-6033M | Recombinant Mouse Snx32 Protein, Myc/DDK-tagged | +Inquiry |
SNX32-1317H | Recombinant Human SNX32 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
SNX32-4990HF | Recombinant Full Length Human SNX32 Protein, GST-tagged | +Inquiry |
SNX32-4300H | Recombinant Human SNX32 Protein, GST-tagged | +Inquiry |
SNX32-15733M | Recombinant Mouse SNX32 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
SNX32-1590HCL | Recombinant Human SNX32 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All SNX32 Products
Required fields are marked with *
My Review for All SNX32 Products
Required fields are marked with *
0
Inquiry Basket