Recombinant Human SOCS2 protein, His-tagged
| Cat.No. : | SOCS2-2871H |
| Product Overview : | Recombinant Human SOCS2 protein(1-198 aa), fused with N-terminal His tag, was expressed in E. coli. |
| Availability | December 15, 2025 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 1-198 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| AA Sequence : | MTLRCLEPSGNGGEGTRSQWGTAGSAEEPSPQAARLAKALRELGQTGWYWGSMTVNEAKEKLKEAPEGTFLIRDSSHSDYLLTISVKTSAGPTNLRIEYQDGKFRLDSIICVKSKLKQFDSVVHLIDYYVQMCKDKRTGPEAPRNGTVHLYLTKPLYTSAPSLQHLCRLTINKCTGAIWGLPLPTRLKDYLEEYKFQV |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Official Symbol | SOCS2 |
| Synonyms | SOCS2; suppressor of cytokine signaling 2; CIS2; Cish2; SOCS 2; SSI 2; SSI2; STAT induced STAT inhibitor 2; STATI2; CIS-2; STAT induced STAT inhibitor-2; STAT-induced STAT inhibitor 2; STAT-induced STAT inhibitor-2; cytokine-inducible SH2 protein 2; suppressor of cytokine signaling-2; SSI-2; SOCS-2; |
| Gene ID | 8835 |
| mRNA Refseq | NM_003877 |
| Protein Refseq | NP_003868 |
| MIM | 605117 |
| UniProt ID | O14508 |
| ◆ Recombinant Proteins | ||
| SOCS2-5323R | Recombinant Rat SOCS2 Protein, His (Fc)-Avi-tagged | +Inquiry |
| Socs2-690R | Recombinant Rat Socs2 Protein, His-tagged | +Inquiry |
| SOCS2-6672H | Recombinant Human SOCS2 Protein (Met1-Val198), N-His tagged | +Inquiry |
| SOCS2-4401R | Recombinant Rhesus monkey SOCS2 Protein, His-tagged | +Inquiry |
| SOCS2-5664R | Recombinant Rat SOCS2 Protein | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| SOCS2-1581HCL | Recombinant Human SOCS2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SOCS2 Products
Required fields are marked with *
My Review for All SOCS2 Products
Required fields are marked with *
